Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G47160-AT5G58787
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.1296850203113
Log2 mRNA fold difference:-0.75270525167637
Log2 TE fold difference:-0.62077473790673
Sequences
Protein sequence

MAKVSFKDSLKALEADIQHANTVLSNELGDEVIFRALDYPREKDGARVQMRLSYTPAAQF
LLFLVQWTDCHLAGTLGLLRVLIYMTYADGKTTMSVYERKTSIKDFYAVIFPSLLQLERG
ITDLDDRKQKEVCKIRYRNKDETEKVKLSEIDIEREEECGICMEMNNMVVLPNCTHSLCI
KCYRDWHGRSESCPFCRDSLKRVNSGDLWMLMEKSDTVNMYTIERENKKRLFVYIEKLPL
VVPDQVFASSPYDCHVK

MAKLSFKDSLKALEADIQHANTLALDYPREKDGARVQMRLSYSPTAQFFLFLVQWTDCKL
AGFLGLLRVLIYMTYADGKTTMSVYERKASIREFQAVILPSLSQLQRGVTDIDDSKQKEV
CKMRYRKKDESEMSEIEIEREEECGICMEMNSKVVLPNCTHSLCIKCYRDWRGRSQSCPF
CRDSLKRVDSGDLWMFLDQNDTVNLTAIARENQKRLFMYIEKLPLVVPDQVYASSPYDFH
VR

www.000webhost.com

Other information
Ka divergence:0.105864KaKs divergence:-0.153323
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):774Length 2 (bp):729Length divergence:-0.03
MFE 1 (kcal):-235.3MFE 2 (kcal):-197.66MFE divergence-0.087