Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G47300-AT5G58640
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SELT-like protein precursor
Function (paralog2):Selenoprotein, Rdx type

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.1135812073955
Log2 mRNA fold difference:0.12959434315205
Log2 TE fold difference:0.93298173499025
Sequences
Protein sequence

MDKTQLILLGLPIFLLCSDLFNLFTPPPPKSQHQSPPSISETLDFPAQKSTGVGYGNTVE
INFCISCSYKGTAVSMKKMLESVFPGLDVVLANYPAPAPKRILAKVVPVAQVGVIGLIMG
GEQIFPMIGIAQPPAWYHSLRANRFGSMASTWLLGNFLQSFLQSSGAFEVSCNGELVFSK
LKEGRFPGEIELRDLISGTMTKPFVTGSY

MDRAQLILLGLPIFLFCSDLFNLFTPPPPKPQPHRPHQPPHIPHQHRPNAIIPETLDFPS
QKTSGLGGAIGYGNTVEINFCVSCSYKGTAVTMKKMLETAFPGLDVILANYPPPAPKRLL
AKVVPVVQMGVIGMIVAGDRILPMIGITNPPAWFHSLRANRFGSMASTWLIGNFLQSYLQ
SSGAFEVHCNGEPVFSKLKEGRFPGEIELRDLISKTLTRPSILTGSSY

Other information
Ka divergence:-0.281718KaKs divergence:-0.519484
GC content 1 (%):44GC content 2 (%):47GC content divergence:0.033
Length 1 (bp):630Length 2 (bp):687Length divergence:0.043
MFE 1 (kcal):-196.8MFE 2 (kcal):-191.3MFE divergence-0.014