Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G47560-AT3G47590
Species:Arabidopsis
Duplication type:TD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):alpha/beta-Hydrolases superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.0049151801969164
Log2 mRNA fold difference:-0.37719437676241
Log2 TE fold difference:0.34611714251849
Sequences
Protein sequence

MDSSQGSTQQKIVILNSHNENLVGLLHETGSTEIVVLCHGFRSNKNFEIMKNVAVAIERE
GISAFRFDFSGNGYVFLSCIILNKLVFVLTLGLWCFHSFRESEGSFYYGNYNYEADDLHS
VIQYFSNLNRVVTIILGHSKGGDVVLLYASKYHDIPNVINLSGRYDLKKGIGERLGEDFL
ERIKQQGYIDVKDGIVIALRFSCTVIRTLVLLSMYWFVTGDSGYRVTEESLMDRLNTDMH
EACLKIDKECRVLTVHGSGDETVPVEDAKEFAKIIPNHELQIVEGADHCYTNYQSQLVLT
VMEFIKSHCEEKNDKTCN

MRTLLHNFNFVPQDSPYYKTSPFPTSSFFNVRFPIKNNQISCNKAKNLRMDPSKGIQEQR
IVIPNRHNEKLVGLLHETGSTDIVVLCHGFRSNKSNQIMNNVAAAIQKEGISAFRFDFSG
NGESEGSFYYGNYNHEADDLHSVVQYFSNKNRVVPIILGHSKGGDVVLLYASKYHDVRNV
INLSGRYDLKKGIRERLGEDFLERIKQQGFIDVGDGKSGYRVTEKSLMDRLSTDIHEACL
KIDKECRVLTVHGSEDEVIPVEDAKEFAKIIPNHKLEIVEGANHGYTEHQSQLVSTVMEF
IKTVIVKNN

Other information
Ka divergence:-0.093852KaKs divergence:-0.387776
GC content 1 (%):40GC content 2 (%):41GC content divergence:0.012
Length 1 (bp):957Length 2 (bp):930Length divergence:-0.014
MFE 1 (kcal):-272.12MFE 2 (kcal):-268.24MFE divergence-0.007