Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G47570-AT3G47580
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Leucine-rich repeat protein kinase family protein
Function (paralog2):Leucine-rich repeat protein kinase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.6048754096884
Log2 mRNA fold difference:0.075375451031726
Log2 TE fold difference:-0.60094316538325
Sequences
Protein sequence

MRLFLLLAFNALMLLETHGFTDETDRQALLQFKSQVSEDKRVVLSSWNHSFPLCNWKGVT
CGRKNKRVTHLELGRLQLGGVISPSIGNLSFLVSLDLYENFFGGTIPQEVGQLSRLEYLD
MGINYLRGPIPLGLYNCSRLLNLRLDSNRLGGSVPSELGSLTNLVQLNLYGNNMRGKLPT
SLGNLTLLEQLALSHNNLEGEIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSSLKLLG
IGYNHFSGRLRPDLGILLPNLLSFNMGGNYFTGSIPTTLSNISTLERLGMNENNLTGSIP
TFGNVPNLKLLFLHTNSLGSDSSRDLEFLTSLTNCTQLETLGIGRNRLGGDLPISIANLS
AKLVTLDLGGTLISGSIPYDIGNLINLQKLILDQNMLSGPLPTSLGKLLNLRYLSLFSNR
LSGGIPAFIGNMTMLETLDLSNNGFEGIVPTSLGNCSHLLELWIGDNKLNGTIPLEIMKI
QQLLRLDMSGNSLIGSLPQDIGALQNLGTLSLGDNKLSGKLPQTLGNCLTMESLFLEGNL
FYGDIPDLKGLVGVKEVDLSNNDLSGSIPEYFASFSKLEYLNLSFNNLEGKVPVKGIFEN
ATTVSIVGNNDLCGGIMGFQLKPCLSQAPSVVKKHSSRLKKVVIGVSVGITLLLLLFMAS
VTLIWLRKRKKNKETNNPTPSTLEVLHEKISYGDLRNATNGFSSSNMVGSGSFGTVYKAL
LLTEKKVVAVKVLNMQRRGAMKSFMAECESLKDIRHRNLVKLLTACSSIDFQGNEFRALI
YEFMPNGSLDMWLHPEEVEEIHRPSRTLTLLERLNIAIDVASVLDYLHVHCHEPIAHCDL
KPSNVLLDDDLTAHVSDFGLARLLLKFDEESFFNQLSSAGVRGTIGYAAPEYGVGGQPSI
NGDVYSFGILLLEMFTGKRPTNELFGGNFTLNSYTKSALPERILDIVDESILHIGLRVGF
PVVECLTMVFEVGLRCCEESPMNRLATSIVVKELISIRERFFKASRTTWR

MKLFLLLSFSAHLLLGADGFTDETDRQALLEFKSQVSEGKRDVLSSWNNSFPLCNWKWVT
CGRKHKRVTHLNLGGLQLGGIVSPSIGNVSFLISLDLSDNAFGGIIPREVGNLFRLEHLY
MAFNSLEGGIPATLSNCSRLLNLDLYSNPLRQGVPSELGSLTKLVILDLGRNNLKGKLPR
SLGNLTSLKSLGFTDNNIEGEVPDELARLSQMVGLGLSMNKFFGVFPPAIYNLSALEDLF
LFGSGFSGSLKPDFGNLLPNIRELNLGENDLVGAIPTTLSNISTLQKFGINKNMMTGGIY
PNFGKVPSLQYLDLSENPLGSYTFGDLEFIDSLTNCTHLQLLSVGYTRLGGALPTSIANM
STELISLNLIGNHFFGSIPQDIGNLIGLQRLQLGKNMLTGPLPTSLGKLLRLGLLSLYSN
RMSGEIPSFIGNLTQLEILYLSNNSFEGIVPPSLGKCSHMLDLRIGYNKLNGTIPKEIMQ
IPTLVNLSMEGNSLSGSLPNDIGSLQNLVKLSLENNKFSGHLPQTLGNCLAMEQLFLQGN
SFDGAIPNIRGLMGVRRVDLSNNDLSGSIPEYFANFSKLEYLNLSINNFTGKVPSKGNFQ
NSTIVFVFGNKNLCGGIKDLKLKPCLAQEPPVETKHSSHLKKVAILVSIGIALLLLLVIA
SMVLCWFRKRRKNQQTNNLVPSKLEIFHEKISYGDLRNATNGFSSSNMVGSGSFGTVFKA
LLPTESKIVAVKVLNMQRRGAMKSFMAECESLKDTRHRNLVKLLTACASTDFQGNEFRAL
IYEYLPNGSVDMWLHPEEVEEIRRPPRTLTLLERLNIVIDVASVLDYLHVHCHEPIAHCD
LKPSNVLLEDDLTAHVSDFGLARLLLKFDKESFLNQLSSAGVRGTIGYAAPEYGMGGQPS
IHGDVYSFGVLLLEMFTGKRPTDELFGGNLTLHSYTKLALPEKVFEIADKAILHIGLRVG
FRTAECLTLVLEVGLRCCEEYPTNRLATSEVAKELISIRERFFKTRRTPRR

www.000webhost.com

Other information
Ka divergence:0.138879KaKs divergence:0.151651
GC content 1 (%):40GC content 2 (%):41GC content divergence:0.012
Length 1 (bp):3033Length 2 (bp):3036Length divergence:0
MFE 1 (kcal):-861.82MFE 2 (kcal):-891.66MFE divergence0.017