Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G47890-AT3G47910
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Ubiquitin carboxyl-terminal hydrolase-related protein
Function (paralog2):Ubiquitin carboxyl-terminal hydrolase-related protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.64743066668536
Log2 mRNA fold difference:0.28041377125528
Log2 TE fold difference:0.3383832528166
Sequences
Protein sequence

MGQKKKAPAPLDSALIKLECEKALKSFGRGSYNKAIRLIKDSCSRHQDSALIHRVQGTIC
VKVAAVYEDLATKQKYLRNAIESARKAVELSPDSIEFGHFYANLLYEAANDGKREYDEVV
QECHRALSIENPIDPAKESLQDETQLKILTPEARIVHVQDELRSLIQKSNISSLSTWMNN
LGKGEEKFRLIPIRRMAEDPIESNLVQTRRPNEIKKANKSIEEIRKEVEVRVAAARLLQQ
KSECENVGAVDNKGSDATLGSGKRSGERRKHGNARRNGSTADRRDRVKSYWDSMSKEMKK
QLLRVKLSDLKSHFSASKDGNENEIISEALSFCEANKTWRFWVCCQCSEKFIKSEAYMHH
IVQVHMGNVLPKMQMVLPQSFDTERIDMLLTSPWKPLDLSAAVKWLRSRQKIQNSEFSEF
HAGDNMDDGDDCFKDARNDTSPEKESLGDSCKGCDENDPEEGKLSITFPPPDGWPISDDP
ERAKLLEKIRAAFELLIRHKYLAASHHDKVIQFTLDELQNLASVSQFLNRSLNQSPICIC
FLGASQLRKILKFLQDLSQACGLSRYSEQSNPNDEFNFGALCREVTEEILLDGEDSCLLL
DEKLLGTECIQEIYMGSALHNVAVASSGDIANGNDVSSGADGFLSWIFTGPSSEEQVVSW
MRTKEEKTNQGLEIMQHLEKEFYHLQNLCERKCEHLSYEGALQTVEDLCLEESRKRETSA
EFTHESYESVLRKRREELNENDLELVFISSRFELDALTNVLKDAETLNHNQFGYEESYGC
TSSQLRDLESGEADEWGMKDSLHEADSFIEVAIQKQKEQLSAELSRIDAQMMRNVTGMQQ
LELKLGPVSSNDYQIVLLPLVKSYMRAHLEALAEKDATEKSDAAREALLFELALDSKKEG
RGRNDNSKHTLEKSKDKKKIKDTRKLKNLKATIGNDHRFNGDSIEHSLLSVASFGDHSEA
DVVSEAIEALSDEEEEYRRCNELEEEERKLAKTLEYQRRIENEAKEKHIAEQKKKYSCSD
PMNVTEAVYDDCIENFFDDADLQEQEKPINQEKWNKQLDDLEGAKVNINGVFPSTNHCVI
SDTAKVLDVISQEVVPNGIAIQAGVFQSDQRPGRRGRRQKASNKLVDGKYQVTLSESEDS
KSQRSGTDSERQSETLRSNGDAGPKTLRQLQAEDDEEERFQADLKRAKLQSLDVYRGRRN
MTSCLRTSLEDNNDWVLSDVTKESQSSPGVAIFGTGLQNEVGEYNCFLNVIIQSLWNLGM
FRAEFLRSSTLEHHHFGDPCVVCSLYAIFTALSTASSETRKEPVAPSSLRIALSNLYPDS
SFFQEAQMNDASEVLAVIFDCLHRSFAQSSSVSDTESAESNSTGSWDCANRSCIAHSLFG
MDVSEQLNCYSCGLESRHLKYTSFFHNINASALRTMKVTCAENSFDELLNLVEMNHQLAC
DREAGGCGKRNHIHHILTTPPHVFTIVLGWQNTCETVEDIAATLAALNTEIDISIMYRGV
DPKNTYSLVSVVCYYGQHYHCFAYSHEHDQWIMYDDQNVKVIGSWSDVLSMCKRGHLQPQ
VLLYEKKL

MGQKKKTSASRSKQPPSSTAVTVVEVEPSEISACSFNDGGFSGPDANGEPLDSSVVKLEC
EKALKSFGRGSYNKAIRLIKDSCSRHQDSALIHRVQGTICVKVAAVYEDLATKQKYLRNA
IESARKAVELSPNSIEFGHFYANLLYEAANEGKREYEEVVQECHRALSIEYPIDPARESL
QDETQLKILTPEARIAHFQDELRSLIQKSNIYSLSTWMQTLGNGEEKFRLIPLRRMAEDP
IESNLIQSRRPNEIKKSTKTNEERRKEIEVRVAAHRLLQQKSESSPSENVEAVNNKGSDS
ALAAGPRSGERRKHGNARKNGSTADRRDRVRSYWDSLSKEMKKEFLRVKFSDLKSHFSGS
KDGQAYEIVSEALSFCEANKTWRFWACCRCSQNFIESEAHMHHIVQAHMGNVLPKMQMVL
PQIVDTERIDMLFKSPWKPLDLSATLKLLRSQQKIQNSEFDEFHSGDNMDGGDDCFKDAW
NDTTPDGDTCNGWNENESEEEVKLSIAFPPPDGWPISDDPERAKLLEKIRAAFEQLIRHK
YLAASHHDKVIQFTLDELQNLPSVSQFLNRGLNKSPLCICFLGASHLSKILKFLQDLSQA
CGLSRYSEQSNPHDEINFGDLGREVTEEILLDSEDSCLLMDEKLLGTECIQEKYMGSAFN
NVTIASSGDIANGNDVSSGADGFLSWIFTGPSSEEQVVSWMRTKEDKTNQGLEIMQHLEK
EFYHLQNLCERKCEHLSYEGALQTVEDLCLEEGRKRETSAEFTHESYETVLRKRREELNE
SDHELLFISSRFELDAITNVLKDAETLNHNQFGYEESYGCTSSQLRDLESGEADEWGIKD
SLHEADSFIEIAIQKQKEQLSAELSRIDAQMMRNVTGMQQLELKLGPVSSNDYQIVLLPL
VKSYMRAHLEALAEKDATEKSDAAREALLVELALDSKKEARGRNDNSKNTLEKSKDKKKI
KDTRKVKDMKATIGSDHRSNADSVEHSPLPVAPVGDHSEADIVSEAVEALKEEEEEYKRQ
IELEEEERKLEKTLEYQRRIEDEAKEKHMAEQQKKYSSSVPMNVAKTVYNGCTDNEVDYL
VLQGQEKSINQEKRNGRLDDLEGASVNTNGVFPSTNHSAISDTAKVQNVKSQKVVPNGTA
MQAGIFQSDQRTGRRTRRQKASNKLADGKYPVTPPETENSKSQLSGTNGERHSETLRNNG
DVGTKTLRQLQAEDDDEERFQADMQRAVLQSLDVYQGGRNMASCLRTPLEVNNDGGLSDD
TMESRSSTGVTIFGTGLQNEVGEYNCFLNVIIQSLWNLELFRAEFLRSSTREHHHVGDPC
VVCSLYEIFTALSAASSEKQNEPVAPSSLRIALSNLYPDSSFFQEAQMNDASEVLAVIFD
CLHRSFAQSSSVSDVDSSDSNCTGSWDCANRTCIAHSLFGMDIFEQLNCYSCGLESRHLK
YTSFFHNINASALRTMKVTCAENSFDELLNLVEMNHQLACDPETGGCGKLNHIHHILTTP
PHVFTTVLGWQNTCETVEDIAATLAALNTEIDISIMYRGLDPKSTYSLVSVVCYYGQHYH
CFAHSREHDQWIMYDDKTVKVIGSWIDVLSMCERGHLQPQVLLYERR

Other information
Ka divergence:-0.0332123KaKs divergence:0.282609
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):4707Length 2 (bp):4824Length divergence:0.012
MFE 1 (kcal):-1469.02MFE 2 (kcal):-1488.69MFE divergence0.007