Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G48050-AT3G48060
Species:Arabidopsis
Duplication type:TD
Function (paralog1):BAH domain ;TFIIS helical bundle-like domain
Function (paralog2):BAH domain ;TFIIS helical bundle-like domain

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.32872779436077
Log2 mRNA fold difference:-0.41842792231271
Log2 TE fold difference:0.056514127887072
Sequences
Protein sequence

MHGRVCERRHKSRRRHMLISSSRVIATVEGGGSSCLSLSSSTSFSKDGRKISVGDCALFK
PPQDCPPFIGIIRLIIAEEEDKLKLGVNWLYRPTELKLGKGILLEAEPNELFYSFHEDNI
PAASLLHPCKVAFLPRGVELPSGISSFVCRRVYDVTNERLWWLTDQDYIDDRQLEVDKLL
CKTRSEMHTTLQQGGRSPKSMNSPTTSQPKDGIQNSNSFLSQGKGRKRERMDHGSESVKR
ERSSRVDDSGSGPLRTESGLKSEILKFTEKGGLVDSEGVEKLVQLMLPERNEKKIDLVGR
AILAGVVAATDKFDCLSRFVQLRGLPVFDEWLQEVHKGKVGDGGSPKDSDRLVDDFLLVL
LRALDKLPVNLNALQTCNIGKSVNHLRSHKNSEIGKKARSLVDTWKKRVEAEMDAKSGSN
QGVSWPGRLSHGGRHSGGSAEANKTSSSHLHASKSVSVKQQVENNLKCVATSPGSTRSAP
SPGSGGNVSKDGQQRNAGAGGVSEVLAAVKDEKSSSSSQSHNNSQSCSSEHAKTGNLCGK
EDARSSTAGSTLKKCSGGSSRHRKSNNVFQGSSSSASPRGAGLSRSFSSHRNVPSEKISQ
SSLTSEKTLEVPLTEGSGNKLIVKLPNRGRSPAQSVSGGSLEDPAPVNSRVSSPVHAVKQ
ELCDNNGREKNHSYRPNVSSVLNAESWQSNELKDILTGSQEAAGSPLVAGDERGGDLKDS
DKASGNVKGTSSLGNEFKSGERHGGTLSSMNALIESCVRYSETNASLAGSDDVGMNLLAS
VAADEMSKSPVASPSVSQPPNSVMNENSTVGNNTKLMASDGLPHEQHQAVCTSVSTEQGE
QHVSSSGTQLESEIKNESKTGDRDKSSNSDTEDLQRLVDQCLESNDNSDGVVASPALPTK
AVKEKILNDSDSGELKDIKTDVKSEADCTSDSTKRVASSMLTECRDVSKKVDSVAVEQTP
LEGVDDDKKEEKPPTALSSELVKKVEEDVPVSSGISRDMDAVSIGRPITEMVNNVAFNHM
DQKDVKKIKQDCDTSVGAIKDTSAGLDSSVTKGKVEPVEGNLENSEVKERYSGLRATPGL
SPKEAEDLERPNGPKTSDADGDEAGECTSAARDASSVSAAASAGSEMDARVEFDLNEGFD
GDDAKHGDSNNFSGSVFLTPTPLQPVKTLPFPVAPVSSGTRASITVAAAAKGPFVPPEDL
LRNKGAVGWRGSAATSAFRPAEPRKPQDVLLSINNTSTSDASTSAGKQTRTFLDFDLNVP
DERVLEDLASQRSGNPTNCTSDITNSFDQVRSGVMGSALDHSSGGLDLDLNKVDDSTDMI
SYTMNSSHRLDSSFQQVKLPSTGGRRDFDLNDGPVGDDAAVEPSMVLNQHSRSGLPSQPS
LSGIRVNGENMASFSTWFPAANAYSAVSMPPIMPERGDQPFPMIATRGPQRMLGPTTGVS
SFTPEGYRGPVLSSSPAMPFQSTTFQYPVFPFGNSFPVTSANFPGASTAHMDSSSSGRAC
FPGVNSQILGPGVPVPSNYPRPYIVGLPNGGSNGGVLDNGAKWFRSGLDLNSGPGGHETE
GRDESTLVARQLSSSASLPLKEDQARMYQMSGGVLKRKEPEGGWDGYRQSSWQ

MHGRVCERRHKSRRRHMLISSSRVIATVEGGGSSCLSLSSSTSFSKDGRKISVGDCALFK
PPQDCPPFIGIIRLIIAEEEDKLKLGVNWLYRPTELKLGKGILLEAEPNELFYSFHEDNI
PAASLLHPCKVAFLPRGVELPSGISSFVCRRVYDVTNERLWWLTDQDYIDDRQLEVDKLL
CKTRSEMHTTLQQGGRSPKSMNSPTTSQPKDGIQNNNSLFSQSKGRKRERMDHGSESVKR
ERSSRVDDSGSGPLRTESGLTSEILKFTEKGGLVDSEGVEKLVQLMLPERNEKKIDLVGR
AILAGFVAATNRFDCLSRFVQLRGLPVFDEWLQEVHKGKVGDGGSPKDSDRLVDDFLLVL
LRALDKLPVNLNALQTCNIGKSVNHLRSHKNSEIGKKARSLVDTWKKRVEAEMDAKSGSN
QGVSWPGRLSHGGRHSGGSAEANKTSSSHLHASKSVSVKQQVENNLKCVATSPGSTRSAP
SPGSGGNVSKDGQQRNAGAGGVSEVLAAVKDEKSSSSSQSHNNSQSCSSEHAKTGNLCGK
EDARSSTAGSTLKKCSGGSSRHRKSNNVFQGSSSSASPRGAGLSRSFSSHRNVPSEKISQ
SSLTSEKTLEVPLTEGSGNKLIVKLPRGRSPAQSVSGGSLEDPAPVNSRVSSPVHTVKQE
LCDNNWREKNHSYRADVSSVLNAESWQSNELKDILTGSQEATGSPLVVAGDEREGALKDS
DKASGNVKATSSLGNEFKSGERHGGTLSSMNALIESCVRYSETNASLAGSDDVGMNLLAS
VAADEMSKSPVASPSVSQPPNSLMNENSTVGNNTKLMASDGLPHKQHQAVRPTLSNEQGE
QHVSSSGTQLESEIKNESKTGDRVKSSNSDTEDLQRFVDQRLESNENSDGVVASPPLPTK
VIKENILDDSDSGEVKDIKTDVKSEADCTSDLTKRVASSMLTECRDVSKMVDSVAVEHTP
LEGVDDDKKEEKPPTALSSELVKKVEEDVPVSSGISRGMDAVSIDRPITEMVNNIAFNHM
DQKDIKKIKQDFDTSVGAVKDASAGLDSSVTKGKVEPVEGNLENIEIMERYSGLRATPGL
SPKEAEDLKRPNAPKTSDADGDEAGECTSAARDASSVSAAASASAGSEMDARVEFDLNEG
FDGDDAQHGDSNNFSGSVVLTPTPLQPVNTLPFPVAPVSSGIPASITVAAAVKGPFVPPE
DLLRYKGAVGWRGSAATSAFRPAEPRKAQDVLLSINNTSTSDASTSAGKQTRTFLDFDLN
VPDERVLEDLASQRSGNPTNCTSGITNNFDQVRSGVMGSALDHSSGGLDLNKVDDLTDMN
SYTMNSSHRLDSSFQQVKLPSTGGRRDFDLNDGPVGDDAAVEPSMVLNQHSRSGLPSQPS
LSGIRVNGENMASFSTWFPAANAYSAVSMPPIMPERGDQPFPMIATRGPQRMLGPTTGVS
SFSPEGYRGPVLSSSPAMPFQSTTFQYPVFPFGNSFPVTPANFPGASTAHMDSSSSGRAY
FPGVNSQILGPGVPVPSNYPRPYIVGLPNGGSNGGVLDNSAKWFRSGLDLNSGPGGHETE
GRDESTLVSRQLSSSASVPSKEDQARMYQMSGGVLKRKEPEGGWDGYRQSL

www.000webhost.com

Other information
Ka divergence:0.329783KaKs divergence:0.809369
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):4842Length 2 (bp):4836Length divergence:-0.001
MFE 1 (kcal):-1558.68MFE 2 (kcal):-1565.89MFE divergence0.002