Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G48340-AT3G48350
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Cysteine proteinases superfamily protein
Function (paralog2):Cysteine proteinases superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-5.4599444362584
Log2 mRNA fold difference:-4.9873377717156
Log2 TE fold difference:-0.47582031375153
Sequences
Protein sequence

MKKLLLIFLFSLVILQTACGFDYDDKEIESEEGLSTLYDRWRSHHSVPRSLNEREKRFNV
FRHNVMHVHNTNKKNRSYKLKLNKFADLTINEFKNAYTGSNIKHHRMLQGPKRGSKQFMY
DHENLSKLPSSVDWRKKGAVTEIKNQGKCGSCWAFSTVAAVEGINKIKTNKLVSLSEQEL
VDCDTKQNEGCNGGLMEIAFEFIKKNGGITTEDSYPYEGIDGKCDASKDNGVLVTIDGHE
DVPENDENALLKAVANQPVSVAIDAGSSDFQFYSEGVFTGSCGTELNHGVAAVGYGSERG
KKYWIVRNSWGAEWGEGGYIKIEREIDEPEGRCGIAMEASYPIKLSSSNPTPKDGDVKDE
L

MKLFFIVLISFLSLLQASKGFDFDEKELETEENVWKLYERWRGHHSVSRASHEAIKRFNV
FRHNVLHVHRTNKKNKPYKLKINRFADITHHEFRSSYAGSNVKHHRMLRGPKRGSGGFMY
ENVTRVPSSVDWREKGAVTEVKNQQDCGSCWAFSTVAAVEGINKIRTNKLVSLSEQELVD
CDTEENQGCAGGLMEPAFEFIKNNGGIKTEETYPYDSSDVQFCRANSIGGETVTIDGHEH
VPENDEEELLKAVAHQPVSVAIDAGSSDFQLYSEGVFIGECGTQLNHGVVIVGYGETKNG
TKYWIVRNSWGPEWGEGGYVRIERGISENEGRCGIAMEASYPTKLSSTPSTHESVVRDDV
KDEL

www.000webhost.com

Other information
Ka divergence:0.174289KaKs divergence:0.208599
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1086Length 2 (bp):1095Length divergence:0.004
MFE 1 (kcal):-306.4MFE 2 (kcal):-329.97MFE divergence0.037