Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G48690-AT3G48700
Species:Arabidopsis
Duplication type:TD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):carboxyesterase 13

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-5.5503749636684
Log2 mRNA fold difference:-3.0182627948229
Log2 TE fold difference:-2.7674283291325
Sequences
Protein sequence

MDSEIAVDCSPLLKIYKSGRIERLMGEATVPPSSEPQNGVVSKDVVYSADNNLSVRIYLP
EKAAAETDSKLPLLVYFHGGGFIIETAFSPTYHTFLTTSVSASNCVAVSVDYRRAPEHPI
SVPFDDSWTALKWVFTHITGSGQEDWLNKHADFSRVFLSGDSAGANIVHHMAMRAAKEKL
SPGLNDTGISGIILLHPYFWSKTPIDEKDTKDETLRMKIEAFWMMASPNSKDGTDDPLLN
VVQSESVDLSGLGCGKVLVMVAEKDALVRQGWGYAAKLEKSGWKGEVEVVESEGEDHVFH
LLKPECDNAIEVMHKFSGFIKGGN

MDSEIAADYSPMLIIYKSGRIERLVGETTVPPSSNPQNGVVSKDVVYSPDNNLSLRIYLP
EKAATAETEASVKLPLLVYFHGGGFLVETAFSPTYHTFLTAAVSASDCVAVSVDYRRAPE
HPIPTSYDDSWTALKWVFSHIAGSGSEDWLNKHADFSKVFLAGDSAGANITHHMTMKAAK
DKLSPESLNESGISGIILVHPYFWSKTPVDDKETTDVAIRTWIESVWTLASPNSKDGSDD
PFINVVQSESVDLSGLGCGKVLVMVAEKDALVRQGWGYWEKLGKSRWNGEVLDVVETKGE
GHVFHLRDPNSEKAHELVHRFAGFIKGDK

www.000webhost.com

Other information
Ka divergence:-0.0836476KaKs divergence:0.999564
GC content 1 (%):48GC content 2 (%):51GC content divergence:0.03
Length 1 (bp):975Length 2 (bp):990Length divergence:0.008
MFE 1 (kcal):-329.56MFE 2 (kcal):-328.07MFE divergence-0.002