Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G49570-AT3G49580
Species:Arabidopsis
Duplication type:TD
Function (paralog1):response to low sulfur 3
Function (paralog2):response to low sulfur 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.384214126444
Log2 mRNA fold difference:0.84045172143027
Log2 TE fold difference:0.85211353771224
Sequences
Protein sequence

MGKGGGYVTVAAEEVEELRRRNGELEREMEEMKKEMVQLWRRTVVAEEAEERLCSQLAEL
EVESLDQARDYHSRIVFLMDQISRLSSSSLEVVVTNS

MANRGGCVTVAAEEMDELRRRNIELSREVAEMKTEMIKLWQRTVVAEEAEEQLCSQLAEL
EVESLEQARDYHDRMLFLMDQISRLSSSSVVSSS

Other information
Ka divergence:0.462595KaKs divergence:0.973279
GC content 1 (%):53GC content 2 (%):54GC content divergence:0.009
Length 1 (bp):294Length 2 (bp):285Length divergence:-0.016
MFE 1 (kcal):-98.2MFE 2 (kcal):-106.6MFE divergence0.041