Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G49670-AT5G65700
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich receptor-like protein kinase family protein
Function (paralog2):Leucine-rich receptor-like protein kinase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.20276660685701
Log2 mRNA fold difference:-0.91381576691956
Log2 TE fold difference:1.0980717042896
Sequences
Protein sequence

MKLLLLLLLLLLLHISHSFTVAKPITELHALLSLKSSFTIDEHSPLLTSWNLSTTFCSWT
GVTCDVSLRHVTSLDLSGLNLSGTLSSDVAHLPLLQNLSLAANQISGPIPPQISNLYELR
HLNLSNNVFNGSFPDELSSGLVNLRVLDLYNNNLTGDLPVSLTNLTQLRHLHLGGNYFSG
KIPATYGTWPVLEYLAVSGNELTGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGNLSE
LVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFTGTITQELGLISSLKSMDLSNNMFT
GEIPTSFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGSIPQKLGENGR
LVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENFLN
GSIPKELFGLPKLSQVELQDNYLTGELPISGGGVSGDLGQISLSNNQLSGSLPAAIGNLS
GVQKLLLDGNKFSGSIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNEL
SGDIPNELTGMKILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYNNLSGLVPSTGQFSY
FNYTSFVGNSHLCGPYLGPCGKGTHQSHVKPLSATTKLLLVLGLLFCSMVFAIVAIIKAR
SLRNASEAKAWRLTAFQRLDFTCDDVLDSLKEDNIIGKGGAGIVYKGTMPKGDLVAVKRL
ATMSHGSSHDHGFNAEIQTLGRIRHRHIVRLLGFCSNHETNLLVYEYMPNGSLGEVLHGK
KGGHLHWNTRYKIALEAAKGLCYLHHDCSPLIVHRDVKSNNILLDSNFEAHVADFGLAKF
LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGV
DIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQI
LTEIPKIPLSKQQAAESDVTEKAPAINESSPDSGSPPDLLSN

MKLFLLLLFLLHISHTFTASRPISEFRALLSLKTSLTGAGDDKNSPLSSWKVSTSFCTWI
GVTCDVSRRHVTSLDLSGLNLSGTLSPDVSHLRLLQNLSLAENLISGPIPPEISSLSGLR
HLNLSNNVFNGSFPDEISSGLVNLRVLDVYNNNLTGDLPVSVTNLTQLRHLHLGGNYFAG
KIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGNLSE
LVRFDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFT
GEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGK
LNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLN
GSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTG
VQKLLLDGNKFQGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELS
GEIPNEITAMKILNYLNLSRNHLVGSIPGSISSMQSLTSLDFSYNNLSGLVPGTGQFSYF
NYTSFLGNPDLCGPYLGPCKDGVAKGGHQSHSKGPLSASMKLLLVLGLLVCSIAFAVVAI
IKARSLKKASESRAWRLTAFQRLDFTCDDVLDSLKEDNIIGKGGAGIVYKGVMPNGDLVA
VKRLAAMSRGSSHDHGFNAEIQTLGRIRHRHIVRLLGFCSNHETNLLVYEYMPNGSLGEV
LHGKKGGHLHWDTRYKIALEAAKGLCYLHHDCSPLIVHRDVKSNNILLDSNFEAHVADFG
LAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEF
GDGVDIVQWVRKMTDSNKDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMRE
VVQILTEIPKLPPSKDQPMTESAPESELSPKSGVQSPPDLLNL

www.000webhost.com

Other information
Ka divergence:-0.298013KaKs divergence:-0.350029
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):3009Length 2 (bp):3012Length divergence:0
MFE 1 (kcal):-934.98MFE 2 (kcal):-945.09MFE divergence0.005