Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G49720-AT5G65810
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.0942296954399
Log2 mRNA fold difference:-1.8446097983115
Log2 TE fold difference:-0.33850026361613
Sequences
Protein sequence

MARRQVGSTRRVGDGGSFPFAGALHSKSRSSPLLSICLVLVGACLLIGYAYSGPGIFKSI
KEVSKVTGDYSCTAEVQRAIPVLKKAYGDGMRKVLHVGPDTCSVVSSLLKEEETEAWGVE
PYDIEDADSHCKSFVSKGLVRVADIKFPLPYRAKSFSLVIVSDALDYLSPKYLNKTVPEL
ARVASDGVVLFAGLPGQQRAKVAELSKFGRPAKMRSASWWNRFFVQTNLEENDAPSKKFE
QAVSKGLYKPACQVFHLKPLH

MSRRQVRRVGDSGSFPFVGALHSKSRSSPLLSVCLVLVGACLLIGYAYSGPGMFKSIREV
SKITGDYSCTAEVQRAIPILKSAYGDSMRKVLHVGPETCSVVSSLLNEEETEAWGVEPYD
VEDADSNCKSLLHKGLVRVADIKFPLPYRSKSFSLVIVSDALDYLSPRYLNKTVPELARV
ASDGVVLLAGNPGQQKAKGGELSKFGRPAKMRSSSWWIRFFSQTNLEENEAASKKFEQAA
SKSSYKPACQVFHLKPLH

Other information
Ka divergence:0.0450201KaKs divergence:0.036855
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):786Length 2 (bp):777Length divergence:-0.006
MFE 1 (kcal):-239.16MFE 2 (kcal):-235.7MFE divergence-0.007