Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G49750-AT5G65830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):receptor like protein 44
Function (paralog2):receptor like protein 57

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.3263866684819
Log2 mRNA fold difference:0.11667746031708
Log2 TE fold difference:1.3842393403561
Sequences
Protein sequence

MTRSHRLLLLLLLIFQTAQRLTTADPNDEACLKNLRQNLEDPASNLRNWTNSVFSNPCSG
FTSYLPGATCNNGRIYKLSLTNLSLRGSISPFLSNCTNLQSLDLSSNQISGVIPPEIQYL
VNLAVLNLSSNHLSGEITPQLALCAYLNVIDLHDNELSGQIPQQLGLLARLSAFDVSNNK
LSGQIPTYLSNRTGNFPRFNASSFIGNKGLYGYPLQEMMMKSKGLSVMAIVGIGLGSGIA
SLMISFTGVCLWLRITEKKIVEEEGKISQSMPDY

MPVNHRFTFSYRLLFLIFLLSFETAQRLVTGDPNDEACLTNLRQSLEDPANNLRNWTKSF
FINPCSGFSSYLHGVICNNGRIYKLSLTNLSLRGSISPFLSNCTNLQSLDLSSNQISGEI
PPQLQFFVNLAVLNLSSNRLSGQISPQIALCAYLNVIDLHDNQLSGQIPFQFGLLARLTA
FDVSNNKLSGQIPSNLAMRNGNLPRFNASSFIGNKKLFGYPLEEMKNKGLSIMAIVGIGL
GSGIASLVISFTGVCIWLKITEKKMEEEEGKISHSMPVY

Other information
Ka divergence:0.287915KaKs divergence:0.43864
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):825Length 2 (bp):840Length divergence:0.009
MFE 1 (kcal):-237.53MFE 2 (kcal):-230.81MFE divergence-0.014