Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G49780-AT5G65870
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):phytosulfokine 4 precursor
Function (paralog2):phytosulfokine 5 precursor

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.1267676162165
Log2 mRNA fold difference:1.6173299393121
Log2 TE fold difference:-0.55235492419678
Sequences
Protein sequence

MGKFTTIFIMALLLCSTLTYAARLTPTTTTALSRENSVKEIEGDKVEEESCNGIGEEECL
IRRSLVLHTDYIYTQNHKP

MVKFTTFLCIIALLLCSTLTHASARLNPTSVYPEENSFKKLEQGEVICEGVGEEECFLIR
RTLVAHTDYIYTQNHNP

www.000webhost.com

Other information
Ka divergence:-0.187688KaKs divergence:-0.571377
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):240Length 2 (bp):234Length divergence:-0.013
MFE 1 (kcal):-53.7MFE 2 (kcal):-44.9MFE divergence-0.089