Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G49800-AT5G65910
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):BSD domain-containing protein
Function (paralog2):BSD domain-containing protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.76391947197249
Log2 mRNA fold difference:0.14303590481794
Log2 TE fold difference:-0.8976560342513
Sequences
Protein sequence

MAWLARSIANSLKIDEEEYDQKETIKTNSIENSGSDQPSSPSVLQTQSPRGVKEDISELT
KTLRSQLWGVASFLAPPPSSSDTADHVDEETRKSSDLAEGDEDLIAGIRNDFVEIGGRFK
TGISKLSGNLPVSKFTNMASNFLQLGSEGVDSKNRDVAIGNAIGVTEEVVLFARDLALHP
ETWLDFPFPDEDDNFDDFEMTDAQYEHALAVENLASSLAALRIELCPAYMSEYCFWRIYF
VLVHPIFSKHDALTLSTPQVLESRALLSHELLRKRNKDTVVVPESSDRGADSENVEPLFQ
PTNPSPKSEPEPVKTITVETIHSAERSEFETEKHTVETKEVQVVDKPVIEERPAPAYHDK
PVQSLVTGSSPRVIDVQVDDDADDWLKDEDNAGTVSATTNHLVQDVDEDVSFSDLEEDDD
DVPVSYKK

MAWLARSIANSLKLDEEDEDDDKHLNQQPSESVSDSQSPRGVKEDISELTKTLRTQFWGV
ASFLSQPSSSPDLQERNQTPDHPEEDEDLIAGIKNDFAEIGGRFRTGISKLSGNLPVSEF
TKIASNFLQLSSEDVDPKDYDVIGVTEELVAFVKDLAMHPETWLDFPLPDDDDSFDDFEL
ADAQYEHALAVERLAPSLASLRIELCPEYMTENCFWRIYFVLVHPKLSKDHALLLSTPQV
LEARSMLSQELQKRSKLPVEAGSSEANTVIVEPLTVPPSPETAAVKIVNPVESSDVETDK
HPIESKEIQIVDKSVIEERSTSTASSSRFINVQVDDEDDDDADDWLNDEETSSVSAIGGR
STTNHPFGEDEEDVSFSDLEEEDDNEGDVKVSYKNLTNSGSDSSDKKSPDWVQLKEVKEK
KKSNDWLDVDAV

www.000webhost.com

Other information
Ka divergence:-0.196094KaKs divergence:-0.253182
GC content 1 (%):45GC content 2 (%):42GC content divergence:-0.034
Length 1 (bp):1287Length 2 (bp):1299Length divergence:0.005
MFE 1 (kcal):-385.14MFE 2 (kcal):-382.27MFE divergence-0.004