Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G49810-AT5G65920
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ARM repeat superfamily protein
Function (paralog2):ARM repeat superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.089621903362422
Log2 mRNA fold difference:-0.65149630943831
Log2 TE fold difference:0.69692545673227
Sequences
Protein sequence

MPMFQPLKRDGLIGFEGGGDGQVLDLDTAVKDGVLGGVNGGGVGVVDEKLDLKKMIKELD
LQDIPSVFICPISLEPMQDPVTLCTGQTYERLNIHKWFNLGHLTCPTTMQELWDDTVTPN
KTLHHLIYTWFSQKYVLMKKRSEDVQGRAIEILGTLKKAKGQARVHALSELKQIVIAHLM
ARKTVVEEGGVSVISSLLGPFTSHAVGSEVVAILVSLDLDSDSKSGLMQPAKVSLIVDML
NDGSNETKINCARLIRGLVEEKGFRAELVSSHSLLVGLMRLVKDKRHRNGVSPALRLLKP
ISVHKQVRSLMVSIGAVPQLVDILPSLDPECLELALFVLDALCTDVEGRVAVKDSANTIP
YTVRVLMRVSENCTNYALSILWSVCKLAPEECSPLAVEVGLAAKLLLVIQSGCDAALKQR
SAELLKLCSLHYSDTMFISKCKLTRTIQ

MPMFQPSKNGGFDGHILDLHSAVKDGVLGGGDGKFLVVVTDEKKKLDLKEMISELELPEI
PSVFICPISLEPMQDPVTLCTGQTYERSNILKWFNIGHCTCPTTMQELWDDLVTPNKTLH
QLIYTWFSQKYVLMKKRSEDVQGRAIEILGTLRKAKGKAKVHALSELKQVVMAHAIAKKT
VVDEGGVFVISSLLSPFTSHAVGSEAIAILVNLELDSDSKAGLMQPARVSLMVDMLNDGS
IETKINCARLIGRLVEEKGFRAELVSSHSLLVGLMRLVKDRRRRNGVSPALTLLKSVSVH
KQVRNLLVRIGAVPQLVDVLPCLDVECLESALFVLDSLCLESEGRIALKDSVNTIPHTVR
LLMKVSEKCTNYAISILWSVCKLASEECSSLAVEVGLAAKLLLVIQSGCDPALKQRSAEL
LKLCSLHYSDSMFISKCKLTRTIQ

Other information
Ka divergence:0.345051KaKs divergence:0.380124
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1347Length 2 (bp):1335Length divergence:-0.004
MFE 1 (kcal):-394.75MFE 2 (kcal):-393.7MFE divergence-0.001