Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G49850-AT5G67580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):telomere repeat binding factor 3
Function (paralog2):Homeodomain-like/winged-helix DNA-binding family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.3113922569973
Log2 mRNA fold difference:0.6698234709785
Log2 TE fold difference:0.64824965947812
Sequences
Protein sequence

MGAPKLKWTPEEETALKAGVLKHGTGKWRTILSDPVYSTILKSRSNVDLKDKWRNISVTA
LWGSRKKAKLALKRTPLSGSRQDDNATAITIVSLANGDVGGQQIDAPSPPAGSCEPPRPS
TSVDKIILEAITSLKRPFGPDGKSILMYIEENFKMQPDMKRLVTSRLKYLTNVGTLVKKK
HKYRISQNYMAEGEGQRSPQLLLEGNKENTPKPEENGVKNLTKSQVGGEVMIMGMTEKEA
AAAAARAVAEAEFAMAEAEEAAREADKAEAEAEAAHIFAKAAMKAVKYRMHSQTR

MGAPKQKWTPEEEAALKAGVLKHGTGKWRTILSDTEFSLILKSRSNVDLKDKWRNISVTA
LWGSRKKAKLALKRTPPGTKQDDNNTALTIVALTNDDERAKPTSPGGSGGGSPRTCASKR
SITSLDKIIFEAITNLRELRGSDRTSIFLYIEENFKTPPNMKRHVAVRLKHLSSNGTLVK
IKHKYRFSSNFIPAGARQKAPQLFLEGNNKKDPTKPEENGANSLTKFRVDGELYMIKGMT
AQEAAEAAARAVAEAEFAITEAEQAAKEAERAEAEAEAAQIFAKAAMKALKFRIRNHPW

www.000webhost.com

Other information
Ka divergence:-0.298189KaKs divergence:-0.647497
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):888Length 2 (bp):900Length divergence:0.007
MFE 1 (kcal):-262MFE 2 (kcal):-255.32MFE divergence-0.013