Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G49880-AT5G67540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glycosyl hydrolase family protein 43
Function (paralog2):Arabinanase/levansucrase/invertase

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.075255625739331
Log2 mRNA fold difference:-0.92088773075894
Log2 TE fold difference:0.80852940625349
Sequences
Protein sequence

MRVMKNKHNKKATFLRCSPFGLVSTVVGCVFMIHLTMLYSRSYSVDLDLSPQLLIHHPIV
RELERVEEENIHMPPPRKRSPRAIKRKPKTPTTLVEEFLDENSQIRHLFFPDMKSAFGPT
KEDTNDTSHYYFPGRIWTDTEGNPIQAHGGGILFDDISKVYYWYGEYKDGPTYLSHKKGA
ARVDIIGVGCYSSKDLWTWKNEGVVLAAEETDETHDLHKSNVLERPKVIYNSDTGKYVMW
MHIDDANYTKASVGVAISDNPTGPFDYLYSRSPHGFDSRDMTVYKDDDNVAYLIYSSEDN
SVLHIGPLTENYLDVKPVMKRIMVGQHREAPAIFKHQNTYYMITSGCTGWAPNEALAHAA
ESIMGPWETLGNPCVGGNSIFRSTTFFAQSTFVIPLPGVPGVFIFMADRWNPADLRDSRY
LWLPLIVGGPADRPLEYSFGFPMWSRVSVYWHRQWRLPSAREKKIA

MKKNNKYNKKSTSLHCNDAGGCRYSLLTIVWTVVGFFLVAHLISLYSRKDNNIHQQVSSD
QLQVVHHLAHPIVRELIRVEEEVLRMPPPRKRSPRTSKRRSRKPIPLVEEFLDDKSPIRH
LFFPGIKTAAFGPTKDMGNETSYYFPGKIWMDTQGNPIQAHGGGILLDVKSNTYYWYGEY
KDGPTYHAHKKGPARVDIIGVGCYSSKDLWTWKNEGIVLGAEETNKTHDLHKSNVLERPK
VIYNEKTEKYVMWMHIDDANYTKASVGVAISNSPTGPFEYLYSKRPHGFDSRDMTVFKDD
DGVAYLIYSSEVNSVLHIGPLTEDYLDVTPVMKRVMVGQHREAPAIFKHQNIYYMVTSWC
TGWAPNEALAHAAESIMGPWEKLGNPCIGGNKVFRLTTFFAQSTYVIPLPGVPGAFIFMA
DRWNPADLRDSRYVWLPLVIGGPADQPLEFNFGFPSWSRVSIYWHSKWRLP

www.000webhost.com

Other information
Ka divergence:-0.0939429KaKs divergence:0.999861
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1401Length 2 (bp):1416Length divergence:0.005
MFE 1 (kcal):-412.2MFE 2 (kcal):-423.52MFE divergence0.014