Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G49910-AT5G67510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Translation protein SH3-like family protein
Function (paralog2):Translation protein SH3-like family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.5253706702259
Log2 mRNA fold difference:-2.2315201018123
Log2 TE fold difference:-0.26101017618576
Sequences
Protein sequence

MKYNPRVTSSRRKNRKAHFTASSSERRVIMSSPLSTDLRQKYNVRSMPIRKDDEVQIVRG
TYKGREGKVVQVYRRKWVIHIERITREKVNGTTVNVGIQPSKVVITKLRLDKDRKSLLER
KAKGRAAADKEKGTKFTSEDVMQNVD

MKFNPRVSSSRRKNRKAHFTAPSSVRRVLMSSPLSKDLRNKHNVRSMPIRKDDEVQVVRG
TFKGREGKVMQVYRRKWVIHIERITREKVNGSTVNVGVNASNVMITKLRLDKDRKSLLER
KANGRAAADKEKGTKFSAEDVMENVD

Other information
Ka divergence:0.23922KaKs divergence:0.999967
GC content 1 (%):47GC content 2 (%):51GC content divergence:0.041
Length 1 (bp):441Length 2 (bp):441Length divergence:0
MFE 1 (kcal):-135.51MFE 2 (kcal):-147.2MFE divergence0.041