Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G49940-AT5G67420
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):LOB domain-containing protein 38
Function (paralog2):LOB domain-containing protein 37

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.194201256436
Log2 mRNA fold difference:1.3230118776184
Log2 TE fold difference:-0.044338950975887
Sequences
Protein sequence

MSCNGCRVLRKGCSENCILRPCIQWIESPEAQGHATVFVAKFFGRAGLMSFISAVPESQC
PALFQSLLYEACGRTVNPVNGAVGLLWTGNWNVCQAAVETVLRGGSLKPIPELLNGGGFA
GFPSPTSDEASEICTEMLNLRKADDSGDRNIYHHCRFSSSRSRSRSTASPPKRKRLSSEQ
QPSSELDLSLIPIYPIKTLPFKEDTPSMYSEESVTTVSFQNNNAGDRYVRCGGGGGGATT
KLLNLFA

MSCNGCRVLRKGCSENCILRPCIQWIETADAQGHATVFVAKFFGRAGLMSFISAVPDSQR
PALFQSLLYEACGRTVNPVNGAIGMLWTGNWNICQAAVETVLRGGSLRPIPELLTHGGGF
AGFPSPTSEEASEICTEMLNLQQNDSTDRNIYHHSRFSSSRSRSTMDSSSPTKRKRLSSE
DQPSSELDLSLIPNFPIKQATPSSTRRRSVTPSMNSEDSGTTTTTTAFCDKGDVYGNGGG
ETTKLLNLFV

www.000webhost.com

Other information
Ka divergence:0.119732KaKs divergence:-0.166326
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):744Length 2 (bp):753Length divergence:0.006
MFE 1 (kcal):-257.3MFE 2 (kcal):-226.51MFE divergence-0.064