Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50000-AT5G67380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):casein kinase II, alpha chain 2
Function (paralog2):casein kinase alpha 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.284780459451
Log2 mRNA fold difference:-0.49160311449771
Log2 TE fold difference:-0.76392565679797
Sequences
Protein sequence

MHLIFFFSYFLRRYLLLLCAILILRAPLAHSLIPPLTCVNTGTVESDVTGIRFDRCLDTD
SLAKISLSTVMSKARVYTDVNVIRPKDYWDYESLNVQWGEQDDYEVVRKVGRGKYSEVFE
GINMNNNEKCIIKILKPVKKKKIRREIKILQNLCGGPNIVKLLDVVRDQHSKTPSLIFEY
VNSTDFKVLYPTLTDYDIRYYIYELLKALDFCHSQGIMHRDVKPHNVMIDHELRKLRLID
WGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYG
HDNQDQLVKIAKVLGTDELNAYLNKYQLELDTQLEALVGRHSRKPWSKFINADNRHLVSP
EAIDYLDKLLRYDHQDRLTAKEAMAHPYFAQVRAAESSRMRTQ

MIDTLFFLFFLFFDSPLRRLLLLCAVLALRAPTAHSPILRSSIVTPTARAVSEVSGCTTI
DPDFLVEISDSNQTRAMSKARVYTEVNVIRPKDYWDYESLIVQWGEQDDYEVVRKVGRGK
YSEVFEGINVNSKEKCIIKILKPVKKKKIRREIKILQNLCGGPNIVKLLDVVRDQHSKTP
SLIFEYVNSTDFKVLYPTLTDYDIRYYIYELLKALDFCHSQGIMHRDVKPHNVMIDHELR
KLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRK
EPFFYGHDNQDQLVKIAKVLGTDELNAYLNKYQLELDPQLEALVGRHSRKPWSKFINADN
QHLVSPEAIDFLDKLLRYDHQDRLTAKEAMAHAYFAQVRAAETSRMRSQ

Other information
Ka divergence:-0.226172KaKs divergence:-0.0890455
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1212Length 2 (bp):1230Length divergence:0.007
MFE 1 (kcal):-363.99MFE 2 (kcal):-358.7MFE divergence-0.007