Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50060-AT5G67300
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myb domain protein 77
Function (paralog2):myb domain protein r1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.530938267008
Log2 mRNA fold difference:3.0669246163651
Log2 TE fold difference:0.5230039111858
Sequences
Protein sequence

MADRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRP
FSPEEDETIVTARAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCSGGVAVTTVTETE
EDQDRPKKRRSVSFDSAFAPVDTGLYMSPESPNGIDVSDSSTIPSPSSPVAQLFKPMPIS
GGFTVVPQPLPVEMSSSSEDPPTSLSLSLPGAENTSSSHNNNNNALMFPRFESQMKINVE
ERGEGRRGEFMTVVQEMIKAEVRSYMAEMQKTSGGFVVGGLYESGGNGGFRDCGVITPKV
E

MADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRP
FSAEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGYDHRGYDGSED
HRPVKRSVSAGSPPVVTGLYMSPGSPTGSDVSDSSTIPILPSVELFKPVPRPGAVVLPLP
IETSSSSDDPPTSLSLSLPGADVSEESNRSHESTNINNTTSSRHNHNNTVSFMPFSGGFR
GAIEEMGKSFPGNGGEFMAVVQEMIKAEVRSYMTEMQRNNGGGFVGGFIDNGMIPMSQIG
VGRIE

www.000webhost.com

Other information
Ka divergence:-0.383051KaKs divergence:-0.0311284
GC content 1 (%):48GC content 2 (%):51GC content divergence:0.03
Length 1 (bp):906Length 2 (bp):918Length divergence:0.007
MFE 1 (kcal):-313.9MFE 2 (kcal):-328.58MFE divergence0.023