Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50070-AT5G67260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CYCLIN D3;3
Function (paralog2):CYCLIN D3;2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.2069986636525
Log2 mRNA fold difference:2.0287963227298
Log2 TE fold difference:-1.0148720528935
Sequences
Protein sequence

MALEEEEESQNAPFCVLDGLFCEEESEFHEQVDLCDESVEKFPFLNLGLSDHDMLWDDDE
LSTLISKQEPCLYDEILDDEFLVLCREKALDWIFKVKSHYGFNSLTALLAVNYFDRFITS
RKFQTDKPWMSQLTALACLSLAAKVEEIRVPFLLDFQVEEARYVFEAKTIQRMELLVLST
LDWRMHPVTPISFFDHIIRRYSFKSHHQLEFLSRCESLLLSIIPDSRFLSFSPSVLATAI
MVSVIRDLKMCDEAVYQSQLMTLLKVDSEKVNKCYELVLDHSPSKKRMMNWMQQPASPIG
VFDASFSSDSSNESWVVSASASVSSSPSSEPLLKRRRVQEQQMRLSSINRMFFDVLSSSP
R

MALEKEEEASQNGAFCVLDGLYCEEETGFVEDDLDDDGDLDFLEKSDESVVKFQFLPLLD
MFLWDDDEILSLISKENETNPCFGEQILDGFLVSCRKEALDWVLRVKSHYGFTSLTAILA
VNYFDRFMTSIKLQTDKPWMSQLVAVASLSLAAKVEEIQVPLLLDLQVEEARYLFEAKTI
QRMELLILSTLQWRMHPVTPISFFDHIIRRFGSKWHQQLDFCRKCERLLISVIADTRFMR
YFPSVLATAIMILVFEELKPCDEVEYQSQITTLLKVNQEKVNECYELLLEHNPSKKRMMN
LVDQDSPSGVLDFDDSSNSSWNVSTTASVSSSSSSPEPLLKRRRVQEQQMRLPSINRMFL
DVLSSPR

www.000webhost.com

Other information
Ka divergence:-0.141803KaKs divergence:-0.0433194
GC content 1 (%):39GC content 2 (%):41GC content divergence:0.025
Length 1 (bp):1086Length 2 (bp):1104Length divergence:0.008
MFE 1 (kcal):-313.84MFE 2 (kcal):-331.91MFE divergence0.028