Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50080-AT5G67250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):VIER F-box proteine 2
Function (paralog2):SKP1/ASK1-interacting protein 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.720281459993
Log2 mRNA fold difference:1.9143042480977
Log2 TE fold difference:-0.36927273729029
Sequences
Protein sequence

MGQAPSSPAEPNVRDTSLCLWSPEFLDCESIGFEDGDYDFTANLPDDCLAHIFQFLSAGD
RKRCSLVSKRWLLVDGQNRHRLSLDAKSEILPFLPCIFNRFDSVTKLALRCDRRSFSLSD
EALFIVSIRCSNLIRVKLRGCREITDLGMESFARNCKSLRKLSCGSCTFGAKGINAMLEH
CKVLEELSLKRIRGLHELAEPIKLSLSASLRSVFLKELVNGQVFGSLVATRTLKKVKIIR
CLGNWDRVFEMNGNGNSSLTEIRLERLQVTDIGLFGISKCSNLETLHIVKTPDCSNLGLA
SVVERCKLLRKLHIDGWRVKRIGDQGLMSVAKHCLNLQELVLIGVDATYMSLSAIASNCK
KLERLALCGSGTIGDAEIGCIAEKCVTLRKFCIKGCLISDVGVQALALGCPKLVKLKVKK
CSLVTGEVREWLRERRMTLVVSMDDDETNGVGLVDGGDQRVLETVVEEEAPPVIDGDGGL
GVAGGGRLGLAILKTKLGLLAGRNLVACTLRRWSQSEATSSI

MGQAPSSTAESNGRELDLRLWSPVIVAGGESMAVGNVVDRDFTGDLPDECLAHVFQFLGA
GDRKRCSLVCKRWLLVDGQSRHRLSLDAKDEISSFLTSMFNRFDSVTKLALRCDRKSVSL
SDEALAMISVRCLNLTRVKLRGCREITDLGMEDFAKNCKNLKKLSVGSCNFGAKGVNAML
EHCKLLEELSVKRLRGIHEAAELIHLPDDASSSSLRSICLKELVNGQVFEPLLATTRTLK
TLKIIRCLGDWDKVLQMIANGKSSLSEIHLERLQVSDIGLSAISKCSNVETLHIVKTPEC
SNFGLIYVAERCKLLRKLHIDGWRTNRIGDEGLLSVAKHCLNLQELVLIGVNATHMSLAA
IASNCEKLERLALCGSGTIGDTEIACIARKCGALRKFCIKGCPVSDRGIEALAVGCPNLV
KLKVKKCKVVTGEIGDWLREQRRTLVVSMDGDETEAVVVVDGEVETVVEEPRVAQAGGIV
AEIGSSNGGGGSRLAMIRSKLGFLAGRNLVTCTFRRWSHNDNASSST

www.000webhost.com

Other information
Ka divergence:-0.3174KaKs divergence:-0.0242511
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1569Length 2 (bp):1584Length divergence:0.005
MFE 1 (kcal):-493.8MFE 2 (kcal):-508.12MFE divergence0.014