Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50260-AT5G67190
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cooperatively regulated by ethylene and jasmonate 1
Function (paralog2):DREB and EAR motif protein 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.54569368881095
Log2 mRNA fold difference:0.12862088590225
Log2 TE fold difference:0.35648066451123
Sequences
Protein sequence

MDAGVAVKADVAVKMKRERPFKGIRMRKWGKWVAEIREPNKRSRLWLGSYSTPEAAARAY
DTAVFYLRGPTATLNFPELLPCTSAEDMSAATIRKKATEVGAQVDAIGATVVQNNKRRRV
FSQKRDFGGGLLELVDLNKLPDPENLDDDLVGK

MEGGGVADVAVPGTRKRDRPYKGIRMRKWGKWVAEIREPNKRSRLWLGSYSTPEAAARAY
DTAVFYLRGPTARLNFPELLPGEKFSDEDMSAATIRKKATEVGAQVDALGTAVQNNRHRV
FGQNRDSDVDNKNFHRNYQNGEREEEEEDEDDKRLRSGGRLLDRVDLNKLPDPESSDEEW
ESKH

www.000webhost.com

Other information
Ka divergence:-0.50784KaKs divergence:-0.683347
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):462Length 2 (bp):555Length divergence:0.091
MFE 1 (kcal):-158.54MFE 2 (kcal):-175.13MFE divergence0.05