Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50270-AT3G50280
Species:Arabidopsis
Duplication type:TD
Function (paralog1):HXXXD-type acyl-transferase family protein
Function (paralog2):HXXXD-type acyl-transferase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.6432197238982
Log2 mRNA fold difference:-1.7981870606581
Log2 TE fold difference:-0.68030251159006
Sequences
Protein sequence

MAGGGVVLVSSSIVRPVNSSQSGRTKIHLTPFDLSLLQFDYPQRGLLFSKPDSDFHLIIS
RLKDSLSLALEIYFPFAGRLVKTENLEDDTVSFFIDCDGSGARFLHTEAKSVSVSDILQP
DGSVPDFLKYFFPADDFKSCDGVSLPLLVIQVTEMKDGVFISFCYNHMVADGVSMWSFFD
TWSKICSTGSCFNYKPLVLKGWFLEGIDYPIHVPVSEAERSPPSREPSSVPITKEWIFHF
TKKNISDLKAKANSEIASSSDLEVSSLQAVSAHMWRSIIRHSGVSREQKTHCRLVVDLRQ
RVNPPLEKDCFGNMVYLSSAITTVEELLDRGLGEAALQIRKLVSSQTNETCKSFAEDWVR
NIKNLNSGIGSKVGNTIVIASSPRFEVYNKDFGWGKPIAIRAGPSNSINGKLSVFQGISE
GSIDVQAILWGDVIVKLLADLEFLEHVTIA

MADVTFISSSIVRPQIINQEGREKIHLTPFDLNLLYVDYTQRGLLFPKPDPETHFISRLR
TSLSSALDIYFPFAGRLNKVENHEDETVSFYINCDGSGAKFIHAVSDSVSVSDLLRPDGS
VPDFFRIFYPMNGVKSIDGLSEPLLALQVTEMRDGVFIGFGYNHMVADGASIWNFFRTWS
KICSNGQRENLQPLALKGLFVDGMDFPIHIPVSDTETSPPSRELSPTFKERVFHFTKRNI
SDLKAKVNGEIGLRDHKVSSLQAVSAHMWRSIIRHSGLNQEEKTRCFVAVDLRQRLNPPL
DKECFGHVIYNSVVTTTVGELHDQGLGWAFLQINNMLRSLTNEDYRIYAENWVRNMKIQK
SGLGSKMTRDSVIVSSSPRFEVYDNDFGWGKPIAVRAGPSNSISGKLVFFRGIEEGCIDV
HAFLLPDVLVKLLADVEFLEKCG

www.000webhost.com

Other information
Ka divergence:-0.272896KaKs divergence:0.70396
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1353Length 2 (bp):1332Length divergence:-0.008
MFE 1 (kcal):-384.92MFE 2 (kcal):-375.8MFE divergence-0.012