Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50310-AT5G67080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):mitogen-activated protein kinase kinase kinase 20
Function (paralog2):mitogen-activated protein kinase kinase kinase 19

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.9967831386429
Log2 mRNA fold difference:3.8184088508321
Log2 TE fold difference:-1.9779780515209
Sequences
Protein sequence

MEWVRGETIGFGTFSTVSTATKSRNSGDFPALIAVKSTDAYGAASLSNEKSVLDSLGDCP
EIIRCYGEDSTVENGEEMHNLLLEYASRGSLASYMKKLGGEGLPESTVRRHTGSVLRGLR
HIHAKGFAHCDIKLANILLFNDGSVKIADFGLAMRVDGDLTALRKSVEIRGTPLYMAPEC
VNDNEYGSAADVWALGCAVVEMFSGKTAWSVKEGSHFMSLLIRIGVGDELPKIPEMLSEE
GKDFLSKCFVKDPAKRWTAEMLLNHSFVTIDLEDDHRENFVVKVKDEDKVLMSPKCPFEF
DDWDSFTLDSNPSFDSPVERLGSLVSGSIPDWSVGGSWLTVR

MEWIRGETIGYGTFSTVSLATRSNNDSGEFPPLMAVKSADSYGAASLANEKSVLDNLGDD
CNEIVRCFGEDRTVENGEEMHNLFLEYASRGSLESYLKKLAGEGVPESTVRRHTGSVLRG
LRHIHANGFAHCDLKLGNILLFGDGAVKIADFGLAKRIGDLTALNYGVQIRGTPLYMAPE
SVNDNEYGSEGDVWALGCVVVEMFSGKTAWSLKEGSNFMSLLLRIGVGDEVPMIPEELSE
QGRDFLSKCFVKDPKKRWTAEMLLNHPFVTVDVDHDVLVKEEDFVVNMKTEDVSTSPRCP
FEFPDWVSVSSGSQTIDSPDERVASLVTDMIPDWSVTNSWVTVR

www.000webhost.com

Other information
Ka divergence:-0.235213KaKs divergence:-0.107861
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1029Length 2 (bp):1035Length divergence:0.003
MFE 1 (kcal):-329.8MFE 2 (kcal):-353.5MFE divergence0.035