Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50340-AT5G67020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.7411521183492
Log2 mRNA fold difference:-1.1073727530553
Log2 TE fold difference:-1.4356141937019
Sequences
Protein sequence

MVDVDRRMTGLRPAHAAGLRRLSARAAAPTTPTVRNSLVSFSSLADQVISHLHTSRIQVQ
PGLTDSEFARAEAEFAFAFPPDLRAVLTAGLPVGAGFPDWRSPGARLHLRAMIDLPIAAV
SFQIARNTLWSKSWGLRPSDPEKALRVARNALKRAPLMIPIFDHCYIPCNPSLAGNPVFY
IDETRIFCCGSDLSDFFERESVFRGSDTCPVVLTKQRSVSEKSAGSSSSSSSNFSRMSLD
SGRVHGSSTPRWVEFWSDAAVDRRRRNSASSMSSSHSSSPERYLDLPRSETPKWVDDYVN
RIGSVLRGGGWSESDVDDIVHVSASGFFEGEMVILDNQAVLDALLLKAGRFSESLRKAGW
SSEEVSDALGFDFRPEKEKKPVKKLSPELVQRIGKLAESVSRS

MVDVDRRMTGLTPAHAAGLRRLSARAAAPSTPTIRNSLQSFSPFADKVINHLKNSGIKIQ
PGLSDTEFARVEAEFGFTFPPDLRVILSAGLSVGAGFPDWRSPGARLHLRAMIDLPVAAV
SFQIAKNSLWCKSWGLKPPDPEKALRVARNALKRAPLLIPIFDHCYIPCNPSLAGNPVFF
IDETRIFCCGSDLSEFFERESAFRSSEFFPRILTKQRSVSEKSAGSSSNFSRRSLDLGRA
NGAGKSRWVEFWSDAAVDRCRRNSASTSSSSSSSPDLPKTETPKWVNQYVNRIGSVLRRG
GWSESDIDEIIHVSASGFFEGEMVIIDNQTVLDVLLLKAGRISESLRKSGWSSEEVSDAL
GFDFRPEKERKPVKKLSPMLVEQFEKLAEWVSQS

www.000webhost.com

Other information
Ka divergence:0.272022KaKs divergence:0.313802
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):1212Length 2 (bp):1185Length divergence:-0.011
MFE 1 (kcal):-422.6MFE 2 (kcal):-382.13MFE divergence-0.05