Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50410-AT5G66940
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):OBF binding protein 1
Function (paralog2):Dof-type zinc finger DNA-binding family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.2530396564173
Log2 mRNA fold difference:-0.55109222475844
Log2 TE fold difference:-0.78868331035107
Sequences
Protein sequence

MPTSDSGEPRRIAMKPNGVTVPISDQQEQLPCPRCDSSNTKFCYYNNYNFSQPRHFCKAC
RRYWTHGGTLRDVPVGGGTRKSAKRSRTCSNSSSSSVSGVVSNSNGVPLQTTPVLFPQSS
ISNGVTHTVTESDGKGSALSLCGSFTSTLLNHNAAATATHGSGSVIGIGGFGIGLGSGFD
DVSFGLGRAMWPFSTVGTATTTNVGSNGGHHAVPMPATWQFEGLESNAGGGFVSGEYFAW
PDLSITTPGNSLK

MPSEFSESRRVPKIPHGQGGSVAIPTDQQEQLSCPRCESTNTKFCYYNNYNFSQPRHFCK
SCRRYWTHGGTLRDIPVGGVSRKSSKRSRTYSSAATTSVVGSRNFPLQATPVLFPQSSSN
GGITTAKGSASSFYGGFSSLINYNAAVSRNGPGGGFNGPDAFGLGLGHGSYYEDVRYGQG
ITVWPFSSGATDAATTTSHIAQIPATWQFEGQESKVGFVSGDYVA

www.000webhost.com

Other information
Ka divergence:0.264857KaKs divergence:-0.256563
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):762Length 2 (bp):678Length divergence:-0.058
MFE 1 (kcal):-242.8MFE 2 (kcal):-218.71MFE divergence-0.052