Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50500-AT5G66880
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SNF1-related protein kinase 2.2
Function (paralog2):sucrose nonfermenting 1(SNF1)-related protein kinase 2.3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.6158673181825
Log2 mRNA fold difference:-0.89398537579692
Log2 TE fold difference:-0.56962299769917
Sequences
Protein sequence

MDPATNSPIMPIDLPIMHDSDRYDFVKDIGSGNFGVARLMTDRVTKELVAVKYIERGEKI
DENVQREIINHRSLRHPNIVRFKEVILTPSHLAIVMEYAAGGELYERICNAGRFSEDEAR
FFFQQLISGVSYCHAMQICHRDLKLENTLLDGSPAPRLKICDFGYSKVLFISLKSSVLHS
QPKSTVGTPAYIAPEILLRQEYDGKLADVWSCGVTLYVMLVGAYPFEDPQEPRDYRKTIQ
RILSVTYSIPEDLHLSPECRHLISRIFVADPATRITIPEITSDKWFLKNLPGDLMDENRM
GSQFQEPEQPMQSLDTIMQIISEATIPTVRNRCLDDFMADNLDLDDDMDDFDSESEIDVD
SSGEIVYAL

MDRAPVTTGPLDMPIMHDSDRYDFVKDIGSGNFGVARLMRDKLTKELVAVKYIERGDKID
ENVQREIINHRSLRHPNIVRFKEVILTPTHLAIIMEYASGGELYERICNAGRFSEDEARF
FFQQLLSGVSYCHSMQICHRDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGT
PAYIAPEVLLRQEYDGKIADVWSCGVTLYVMLVGAYPFEDPEEPRDYRKTIQRILSVKYS
IPDDIRISPECCHLISRIFVADPATRISIPEIKTHSWFLKNLPADLMNESNTGSQFQEPE
QPMQSLDTIMQIISEATIPAVRNRCLDDFMTDNLDLDDDMDDFDSESEIDIDSSGEIVYA
L

www.000webhost.com

Other information
Ka divergence:-0.349352KaKs divergence:-0.301811
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1110Length 2 (bp):1086Length divergence:-0.011
MFE 1 (kcal):-328.32MFE 2 (kcal):-312.35MFE divergence-0.025