Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50650-AT5G66770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):GRAS family transcription factor
Function (paralog2):GRAS family transcription factor

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.77538559983166
Log2 mRNA fold difference:0.31505246733203
Log2 TE fold difference:0.31168621687882
Sequences
Protein sequence

MAYMCTDSGNLMAIAQQLIKQKQQQQSQHQQQEEQEQEPNPWPNPSFGFTLPGSGFSDPF
QVTNDPGFHFPHLEHHQNAAVASEEFDSDEWMESLINGGDASQTNPDFPIYGHDPFVSFP
SRLSAPSYLNRVNKDDSASQQLPPPPASTAIWSPSPPSPQHPPPPPPQPDFDLNQPIFKA
IHDYARKPETKPDTLIRIKESVSESGDPIQRVGYYFAEALSHKETESPSSSSSSSLEDFI
LSYKTLNDACPYSKFAHLTANQAILEATNQSNNIHIVDFGIFQGIQWSALLQALATRSSG
KPTRIRISGIPAPSLGDSPGPSLIATGNRLRDFAAILDLNFEFYPVLTPIQLLNGSSFRV
DPDEVLVVNFMLELYKLLDETATTVGTALRLARSLNPRIVTLGEYEVSLNRVEFANRVKN
SLRFYSAVFESLEPNLDRDSKERLRVERVLFGRRIMDLVRSDDDNNKPGTRFGLMEEKEQ
WRVLMEKAGFEPVKPSNYAVSQAKLLLWNYNYSTLYSLVESEPGFISLAWNNVPLLTVSS
WR

MAYMCTDSGNLMAIAQQVIKQKQQQEQQQQQHHQDHQIFGINPLSLNPWPNTSLGFGLSG
SAFPDPFQVTGGGDSNDPGFPFPNLDHHHATTTGGGFRLSDFGGGTGGGEFESDEWMETL
ISGGDSVADGPDCDTWHDNPDYVIYGPDPFDTYPSRLSVQPSDLNRVIDTSSPLPPPTLW
PPSSPLSIPPLTHESPTKEDPETNDSEDDDFDLEPPLLKAIYDCARISDSDPNEASKTLL
QIRESVSELGDPTERVAFYFTEALSNRLSPNSPATSSSSSSTEDLILSYKTLNDACPYSK
FAHLTANQAILEATEKSNKIHIVDFGIVQGIQWPALLQALATRTSGKPTQIRVSGIPAPS
LGESPEPSLIATGNRLRDFAKVLDLNFDFIPILTPIHLLNGSSFRVDPDEVLAVNFMLQL
YKLLDETPTIVDTALRLAKSLNPRVVTLGEYEVSLNRVGFANRVKNALQFYSAVFESLEP
NLGRDSEERVRVERELFGRRISGLIGPEKTGIHRERMEEKEQWRVLMENAGFESVKLSNY
AVSQAKILLWNYNYSNLYSIVESKPGFISLAWNDLPLLTLSSWR

Other information
Ka divergence:-0.150451KaKs divergence:0.0825864
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):1629Length 2 (bp):1755Length divergence:0.037
MFE 1 (kcal):-496.41MFE 2 (kcal):-551.24MFE divergence0.052