Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50700-AT5G66730
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):indeterminate(ID)-domain 2
Function (paralog2):C2H2-like zinc finger protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.72278219521633
Log2 mRNA fold difference:0.16058202118375
Log2 TE fold difference:0.50657306861857
Sequences
Protein sequence

MPVDLDNSSTVSGEASVSISSTGNQNPLPNSTGKKKRNLPGMPDPESEVIALSPKTLLAT
NRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQKSNKEVKKKVYVCPEVSCVHHDPSRAL
GDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQSDWKAHSKICGTKEYKCDCGTLFSRRDSF
ITHRAFCDALAEENARSHHSQSKKQNPEILTRKNPVPNPVPAPVDTESAKIKSSSTLTIK
QSESPKTPPEIVQEAPKPTSLNVVTSNGVFAGLFESSSASPSIYTTSSSSKSLFASSSSI
EPISLGLSTSHGSSFLGSNRFHAQPAMSATALLQKAAQMGAASSGGSLLHGLGIVSSTST
SIDAIVPHGLGLGLPCGGESSSGLKELMMGNSSVFGPKQTTLDFLGLGRAVGNGNGPSNG
LSTLVGGGTGIDMATTFGSGEFSGKDISRRKS

MPVDLDNSSTVSGDASVSSTGNQNLTPKSVGKKKRNLPGMPDPDAEVIALSPKTLMATNR
FVCEICNKGFQRDQNLQLHRRGHNLPWKLRQRSTKEVRKKVYVCPVSGCVHHDPSRALGD
LTGIKKHFCRKHGEKKWKCEKCSKKYAVQSDWKAHSKICGTKEYKCDCGTLFSRRDSFIT
HRAFCDALAEESAKNHTQSKKLYPETVTRKNPEIEQKSPAAVESSPSLPPSSPPSVAIAP
APAISVETESVKIISSSVLPIQNSPESQENNNHPEVIIEEASRTIGFNVSSSDLSNDHSN
NNGGYAGLFVSSTASPSLYASSTASPSLFAPSSSMEPISLCLSTNPSLFGPTIRDPPHFL
TPLPPQPAMSATALLQKAAQMGSTGSGGSLLRGLGIVSTTSSSMELSNHDALSLAPGLGL
GLPCSSGGSGSGLKELMMGNSSVFGPKQTTLDFLGLGRAVGNGGNTGGGLSALLTSIGGG
GGIDLFGSGEFSGKDIGRSS

www.000webhost.com

Other information
Ka divergence:0.152472KaKs divergence:0.124614
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):1359Length 2 (bp):1503Length divergence:0.05
MFE 1 (kcal):-373.67MFE 2 (kcal):-444.54MFE divergence0.087