Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50740-AT5G66690
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):UDP-glucosyl transferase 72E1
Function (paralog2):UDP-Glycosyltransferase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.9858859131601
Log2 mRNA fold difference:-2.9690522901743
Log2 TE fold difference:-0.56753577087528
Sequences
Protein sequence

MKITKPHVAMFASPGMGHIIPVIELGKRLAGSHGFDVTIFVLETDAASAQSQFLNSPGCD
AALVDIVGLPTPDISGLVDPSAFFGIKLLVMMRETIPTIRSKIEEMQHKPTALIVDLFGL
DAIPLGGEFNMLTYIFIASNARFLAVALFFPTLDKDMEEEHIIKKQPMVMPGCEPVRFED
TLETFLDPNSQLYREFVPFGSVFPTCDGIIVNTWDDMEPKTLKSLQDPKLLGRIAGVPVY
PIGPLSRPVDPSKTNHPVLDWLNKQPDESVLYISFGSGGSLSAKQLTELAWGLEMSQQRF
VWVVRPPVDGSACSAYLSANSGKIRDGTPDYLPEGFVSRTHERGFMVSSWAPQAEILAHQ
AVGGFLTHCGWNSILESVVGGVPMIAWPLFAEQMMNATLLNEELGVAVRSKKLPSEGVIT
RAEIEALVRKIMVEEEGAEMRKKIKKLKETAAESLSCDGGVAHESLSRIADESEHLLERV
RCMARGA

MHITKPHAAMFSSPGMGHVIPVIELGKRLSANNGFHVTVFVLETDAASAQSKFLNSTGVD
IVKLPSPDIYGLVDPDDHVVTKIGVIMRAAVPALRSKIAAMHQKPTALIVDLFGTDALCL
AKEFNMLSYVFIPTNARFLGVSIYYPNLDKDIKEEHTVQRNPLAIPGCEPVRFEDTLDAY
LVPDEPVYRDFVRHGLAYPKADGILVNTWEEMEPKSLKSLLNPKLLGRVARVPVYPIGPL
CRPIQSSETDHPVLDWLNEQPNESVLYISFGSGGCLSAKQLTELAWGLEQSQQRFVWVVR
PPVDGSCCSEYVSANGGGTEDNTPEYLPEGFVSRTSDRGFVVPSWAPQAEILSHRAVGGF
LTHCGWSSTLESVVGGVPMIAWPLFAEQNMNAALLSDELGIAVRLDDPKEDISRWKIEAL
VRKVMTEKEGEAMRRKVKKLRDSAEMSLSIDGGGLAHESLCRVTKECQRFLERVVDLSRG
A

www.000webhost.com

Other information
Ka divergence:0.122052KaKs divergence:0.512091
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):1464Length 2 (bp):1446Length divergence:-0.006
MFE 1 (kcal):-502.98MFE 2 (kcal):-518.52MFE divergence0.015