Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50820-AT5G66570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):photosystem II subunit O-2
Function (paralog2):PS II oxygen-evolving complex 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.4612334633307
Log2 mRNA fold difference:1.2163518958212
Log2 TE fold difference:0.22665858613632
Sequences
Protein sequence

MATSLQAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSQARLTCSLHSDLKDFAGK
CSDAAKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS
ETFSFKAGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVG
SDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPESFSGKFLVPSYRGSSF
LDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKITKSKPETGEVIG
VFESLQPSDTDLGAKVPKDVKIQGVWYGQIE

MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG
KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG
SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
ASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSS
FLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVI
GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE

Other information
Ka divergence:-0.0692668KaKs divergence:-0.0516605
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):996Length 2 (bp):999Length divergence:0.002
MFE 1 (kcal):-349.3MFE 2 (kcal):-345.34MFE divergence-0.006