Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50840-AT5G66560
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phototropic-responsive NPH3 family protein
Function (paralog2):Phototropic-responsive NPH3 family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.0214475067755
Log2 mRNA fold difference:-7.5528096097662
Log2 TE fold difference:5.724552256841
Sequences
Protein sequence

MANSKKQAWFFYTTGLPSDIEIEVDDITFHLHKFPLMSKSKKLHQLITEQEQSKVYSHIK
LENFPGGSEIFEMVIKISYGFKVDISVSTAVPLRCAAEYLEMTEEYSPENLISKTEKFLS
EFVFTNVQESIKALKACESVSSLAESLCITEQCIDSIVFQASSTDPSSFYGWPINNGGIF
TVDRKKQSKDSKTELWFEDLTELSFPIFRRVILSMKSSVLSPEIVERSLLTYAKKHIPGI
SRSSSASSSSSSSSTTIASENQQRELLETITSDLPLTATTTRSLFGLLRAAIILNASENC
RKFLEKKIGSNLEKATLDDLLIPSYSYLNETLYDIDLVERLLRRFLENVAVSSSSLTVVG
RLIDGVLGEIASDANLKPEQFYNLAVLLPVQARVYDDGLYRAVDIYFKTHSWILEEEKEK
ICSVMDCRKLTVEGCTHAAQNERLPLRAVVQVLFLEQLQLRQVITGTLLTEEDGDKTVVD
LGRWKEAVKENQVLRLDMDTMRTRVNQLEKECLYLKKVIAKIDKESLLKAKHGAGKWSIG
KKFGCKFSAQVCDSQEATMVDRRSRRFLS

MASEKSTSKGQAWFCTTGLPSDIEIEVDDMTFHLHKFPLMSKSRKLHRLITEQETRSSSS
MALITVIDPKVEETDKKGKGHEIEDDKEEEEVEEQEIEENGYPHIKLEDFPGSSESFEMV
AKFCYGVKMDLSASTVVPLRCAAEHLEMTEEYSPDNLISKTERFLSHSVYKSLRESIKAL
KACESVSPLAGSLGITEQCIDSIVSRASSADPSLFGWPVNDGGGRGNISATDLQLIPGGA
AKSRKKPSRDSNMELWFEDLTQLSLPIFKTVILSMRSGDLSSDIIESCLICYAKKHIPGI
LRSNRKPPSSSSTAVSENEQRELLETITSNLPLDKSSISSTTRFLFGLLRTAIILNAAEI
CRDLLERKIGSQLERATLDDLLVPSYSYLNETLYDVDLVERILGHFLDTLEQSNTAIVEV
DGKSPSLMLVGKLIDGFLAEIASDANLKSDKFYNLAISLPDQARLYDDGLYRAVDVYLKA
HPWVSEAEREKICGVMDCQKLTLEACTHAAQNERLPLRAVVQVLFFEQLQLRHAIAGTLL
AAQSPSTSQSTEPRPSAAIRNLTITEEDGDEAEGERQVDAGKWKKTVRENQVLRLDMDTM
RTRVHRLERECSNMKKVIAKIDKEGSSPATTTDRPRSWSITKKFGCKFKTQVCDSHEATM
VDHRSRRS

Other information
Ka divergence:-0.602045KaKs divergence:-0.24836
GC content 1 (%):43GC content 2 (%):48GC content divergence:0.055
Length 1 (bp):1710Length 2 (bp):2007Length divergence:0.08
MFE 1 (kcal):-509MFE 2 (kcal):-636.5MFE divergence0.111