Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50900-AT5G66490
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.5349238359701
Log2 mRNA fold difference:0.28451866433147
Log2 TE fold difference:1.1374867360625
Sequences
Protein sequence

MFRAMSTRKIHGGYEKLGDEEARLKRVSSVPASVYGHSRNPVQEVKKTPTAKPTGGSVHP
LFSFFDVHFQRKKKNTAKKKSLATAKPEFARYMEYVREGGVWDPSSNAPVIHYR

MIRALSTRKVRGSYKKLGDEEEAGAGLLEVKPESVPTNPHGQSPKVNKPVEKTRGSAHPL
FSFFEMSLKRKKKKKSTTTAKPEFARYLEYVKEGGVWDNTSNGPAIYYR

www.000webhost.com

Other information
Ka divergence:0.285122KaKs divergence:0.222504
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):345Length 2 (bp):330Length divergence:-0.022
MFE 1 (kcal):-87.6MFE 2 (kcal):-99.46MFE divergence0.063