Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50920-AT5G66450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phosphatidic acid phosphatase (PAP2) family protein
Function (paralog2):Phosphatidic acid phosphatase (PAP2) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.5044318578021
Log2 mRNA fold difference:0.16978130442773
Log2 TE fold difference:1.304134364919
Sequences
Protein sequence

MAASSSLLLLLHCPTCNFYFDSSSYLKRSRLSSYSSIISRGSPLFVSSFGSMTVKRFSSR
VGSRSNDGNEQFGALEQESFINNSSEIRKDLVTGGGIEAIVNRLSKWVVSVLFGSIILLR
HDGAALWAVIGSISNSALSVVLKRILNQERPTTTLRSDPGMPSSHAQSISFISVFAVLSV
MEWLGTNGVSLFLSGLILALGSYFIRLRVSQKLHTSSQVVVGAIVGSLFCILWYTMWNSL
LREAFEASLLVQISVFLFAATFALAFAAYVVLNWFKDER

MAASSSSLLLLHKPTYNFHFAASSVPTYINSARFRISSSIFPLDRRRRRRIWSVSGFKSM
ADLVKTNARRDGEDRFQALEQEAFISNSSSELQNELVSDAGDGIEAIANRLSKWIVAALF
GSVLLLRHDGAALWAVIGSVSNSVLSVALKRILNQERPVATLRSDPGMPSSHAQSISFIS
VFSVFSVMEWLGTNVLSLFLSGFILALGSYFTWLRVSQKLHTTSQVVVGAIVGSVYSTLW
YVTWNSLVLEAFTSTFSVQIALFLVAAASALGFAVYVLLNWFKDDR

www.000webhost.com

Other information
Ka divergence:-0.264281KaKs divergence:-0.530744
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):840Length 2 (bp):861Length divergence:0.012
MFE 1 (kcal):-232.57MFE 2 (kcal):-251.51MFE divergence0.039