Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G50960-AT5G66410
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):phosducin-like protein 3 homolog
Function (paralog2):phosducin-like protein 3 homolog

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.080854411186
Log2 mRNA fold difference:1.7011543620569
Log2 TE fold difference:0.26170662160483
Sequences
Protein sequence

MDPDAVKSTLSNLAFGNVMAAAARNYQKEVLANEKAQGSNPVNEEVDLDELMDDPELERL
HADRIAALKREVEKRESFKRQGHGEYREVSEGDFLGEVTRSEKVICHFYHKEFYRCKIMD
KHLKTLAPRHVDTKFIKVDAENAPFFVTKLAIKTLPCVVLFSKGVAMDRLVGFQDLGTKD
DFTTNKLENVLLKKGMLSKKKKEEDDEDAEYQESIRRSVRSSENLDSDSD

MDPDTVKSTLSNLAFGNVLAAAARDYKKEVLANEKAQGSRPVNEEVDLDELMDDPELEKL
HADRIAALRREVEKREAFKRQGHGEYREVSEGDFLGEVTRSEKVICHFYHKEFYRCKIMD
KHLKTLAPRHVDTKFIKMDAENAPFFVTKLAIKTLPCVILFSKGIAMDRLVGFQDLGAKD
DFSTTKLENLLVKKGMLSEKRKEEDEEDYEYQESIRRSVRSSANVDSDSD

www.000webhost.com

Other information
Ka divergence:-0.170533KaKs divergence:-0.0300842
GC content 1 (%):42GC content 2 (%):45GC content divergence:0.034
Length 1 (bp):693Length 2 (bp):693Length divergence:0
MFE 1 (kcal):-198.62MFE 2 (kcal):-203.1MFE divergence0.011