Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G51080-AT5G66320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):GATA transcription factor 6
Function (paralog2):GATA transcription factor 5

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.2743552598179
Log2 mRNA fold difference:-0.74232645094004
Log2 TE fold difference:2.972352263273
Sequences
Protein sequence

MESVELTLKNSNMKDKTLTGGAQNGDDFSVDDLLDFSKEEEDDDVLVEDEAELKVQRKRG
VSDENTLHRSNDFSTADFHTSGLSVPMDDIAELEWLSNFVDDSSFTPYSAPTNKPVWLTG
NRRHLVQPVKEETCFKSQHPAVKTRPKRARTGVRVWSHGSQSLTDSSSSSTTSSSSSPRP
SSPLWLASGQFLDEPMTKTQKKKKVWKNAGQTQTQTQTQTRQCGHCGVQKTPQWRAGPLG
AKTLCNACGVRYKSGRLLPEYRPACSPTFSSELHSNHHSKVIEMRRKKETSDGAEETGLN
QPVQTVQVVSSF

MEQAALKSSVRKEMALKTTSPVYEEFLAVTTAQNGFSVDDFSVDDLLDLSNDDVFADEET
DLKAQHEMVRVSSEEPNDDGDALRRSSDFSGCDDFGSLPTSELSLPADDLANLEWLSHFV
EDSFTEYSGPNLTGTPTEKPAWLTGDRKHPVTAVTEETCFKSPVPAKARSKRNRNGLKVW
SLGSSSSSGPSSSGSTSSSSSGPSSPWFSGAELLEPVVTSERPPFPKKHKKRSAESVFSG
ELQQLQPQRKCSHCGVQKTPQWRAGPMGAKTLCNACGVRYKSGRLLPEYRPACSPTFSSE
LHSNHHRKVIEMRRKKEPTSDNETGLNQLVQSPQAVPSF

Other information
Ka divergence:-0.260106KaKs divergence:-0.435369
GC content 1 (%):48GC content 2 (%):55GC content divergence:0.068
Length 1 (bp):939Length 2 (bp):1020Length divergence:0.041
MFE 1 (kcal):-300.8MFE 2 (kcal):-371.2MFE divergence0.105