Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G51150-AT5G66310
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ATP binding microtubule motor family protein
Function (paralog2):ATP binding microtubule motor family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.03144968894846
Log2 mRNA fold difference:-0.36421459426243
Log2 TE fold difference:0.38356512282857
Sequences
Protein sequence

MGIGEDQMQGSSGREEKIFVSVRLRPLNVRERARNDVADWECINDETVIYRSHLSISERS
MYPTAYTFDRVFGPECSTREVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMIGITD
YALADIYDYIEKHNEREFILKFSAMEIYNESVRDLLSTDISPLRVLDDPEKGTVVEKLTE
ETLRDWNHFKELLSICIAQRQIGETALNEVSSRSHQILRLTVESTAREYLAKDKFSTLTA
TVNFIDLAGSERASQSLSAGTRLKEGGHINRSLLTLGTVIRKLSKGKNGHIPFRDSKLTR
ILQTSLGGNARTSIICTLSPARVHVEQSRNTLLFASCAKEVTTNAQVNVVMSDKALVRHL
QRELAKLESELSSPRQALVVSDTTALLKEKDLQIEKLNKEVFQLAQELERAYSRIEDLQQ
IIGEAPQQEILSTDSEQTNTNVVLGRQYPKLRVRSSWESLNITPESPLSAQASIMISPQS
TEHGSDENVFQLSDLRLNSGASSPAQHLAFVTPGKFTKVRLNIRGVESKNQLHIHKGESV
DQSRVQGERLHEMDEPSEVDSEDTCTELQCIETESPGIIMYPEPNILPDRCKAVSALPLC
EPESKNSRPPTETAEEKEEKEETEEKEEEEEERVKEVSSVSIQTKEKSGPIKVSPRCVLS
LTDESFPDESSNLKRDPTHQDFVTPSPEKLYAWHLESNGQTAGGTGFTRSRSCGASFVSS
SSFSLSERDANTPPCWYQNERAESNLKPSNSKRPPLPKHISRMSMPATWFEKDFNHTQRM
PAGLDGVNMIKSSPNGSQVSTSKSHVYARQTSGRALISQDEGEETVPQRDKRIIHLSMEE
IEQKFLALRSSKSFKDAAVDPIQDYLTMPLNWPLEFKRLEMEIIELWHACNVSLSHRSYF
FLLFRGDQKDCLYMEVELRRLKYIRETFTHNNKAIENGRTLTSMSSLRALNRERYKLSQL
MQKKLTKEERENVFLRWGIGLNTKHRRLQLAHRLWSESKDMDHVRESASVVGKLMGFVDM
DLASKEMFGLNFSLRPRAKKSSLWKRSVLSLSIL

MTTEDDDQMLGPSGTQEKIYVSVRMRPLNDKEKFRNDVPDWECINNTTIIYRSHLSISER
SMYPSAYTFDRVFSPECCTRQVYEQGAKEVAFSVVSGVNASVFAYGQTSSGKTYTMSGIT
DCALVDIYGYIDKHKEREFILKFSAMEIYNESVRDLLSTDTSPLRLLDDPEKGTVVEKLT
EETLRDWNHFKELLSVCKAQRQIGETALNEVSSRSHQILRLTVESIAREFSTNDKFSTLT
ATVNFIDLAGSERASQSLSAGTRLKEGCHINRSLLTLGTVIRKLSKEKTGHIPFRDSKLT
RILQSSLGGNARTAIICTMSPARIHVEQSRNTLLFASCAKEVTTNAQVNVVMSDKALVKH
LQRELAKLESELRSPSQASIVSDTTALLTEKDLEVEKLKKEVFQLAQQLEQARSEIKDLR
RMVEEEKNQEKETLSTETEGLNVLMEHQYPKLRVRRTWDSENTTPLSPISAHRSSISPRS
TEYSYEENVFQLSDFRIDSASSSPQQLAFVTPFLKVPLDDIHVTDTVDQSHVHKEEAIEE
PHVQEERFYEMAEHTDGNSEDNCREVRCIETEKSDISIGPVENMPESSPDKYEAVTAEEP
VSVTEPKNLQHPTEEAVCVTETKNLQHPTEAENEEEEEEERVKEVSGASPEPKQESNLTK
NPALCDLECSPDEFDTSMSNLSRISTPPALITPSPEKPFSWIMERDSQLFRGMKLTRSRS
CRPSLLSSPSSSWLEKDADTPPSWYDKEFIKTAERNLTMCDIKNQRLLQDEFSGRSMPTT
WFERSLSDTQTVDAASHGVSNEMSPNESPFRPSDASVFELQTSGRASISQDRTEETAAQK
DKQIIHRSMEEREQKFLASNSTKSFKDAAMDPIQDYLDTALNWPVEFKRLQREIIELWHV
CKVSMAHRSYFFLLFRGDQKDCLYLEVELRRLKYIRESFAQNSNDGNNMTLISCTRALTR
ERYKLSKLMQRKLSKEERENLFLRWGIGLNTNHRRVQLARRLWSDYKDMGHVRESASLVG
KLNGFVDMKLTSTEMFGVNYAFRPPRPKKSSLWKRSVLSLSFL

www.000webhost.com

Other information
Ka divergence:-0.0584677KaKs divergence:-0.0518473
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):3165Length 2 (bp):3192Length divergence:0.004
MFE 1 (kcal):-952.4MFE 2 (kcal):-932.59MFE divergence-0.011