Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G51260-AT5G66140
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):20S proteasome alpha subunit PAD1
Function (paralog2):proteasome alpha subunit D2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.49875778858452
Log2 mRNA fold difference:-1.4502689081462
Log2 TE fold difference:0.98173598258123
Sequences
Protein sequence

MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSRSA
RKIVSLDNHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYT
QSGGVRPFGLSTLIVGFDPYTRIPALYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKE
SAGQETVKLAIRALLEVVESGGKNIEVAVMTREEGVLKQLEEEEIDIIVAEIEAEKAAAE
AAKKGPAKET

MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSRSA
RKIVSLDNHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYT
QSGGVRPFGLSTLIVGFDPYSRLPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKE
SSGQETIKLAIRALLEVVESGGKNIEVAVMTREETGLRQLEEAEIDAIVAKIEAEKAAAE
AAKKGPPKET

www.000webhost.com

Other information
Ka divergence:-0.530939KaKs divergence:-0.999982
GC content 1 (%):48GC content 2 (%):51GC content divergence:0.03
Length 1 (bp):753Length 2 (bp):753Length divergence:0
MFE 1 (kcal):-242.75MFE 2 (kcal):-239.62MFE divergence-0.006