Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G51420-AT3G51430
Species:Arabidopsis
Duplication type:TD
Function (paralog1):strictosidine synthase-like 4
Function (paralog2):Calcium-dependent phosphotriesterase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.80377667564353
Log2 mRNA fold difference:-0.98359830239101
Log2 TE fold difference:0.0050160825869277
Sequences
Protein sequence

MVLFFSTRFLFFSIFFPCLISITLYQLDSFEPASLPADSLITSPTSIPPLLNDRFLTGAE
FIGVGLLNNPEDIAYHKDSNLIYTGCVDGWVKRVSVHDSANDSIVEDWVNTGGRPLGIAF
GLHGEVIVADANKGLLSISDGGKKTELLTDEADGVRFKLTDAVTVADNGVLYFTDASSKY
DFYQFIFDFLEGKPHGRVMSFDPTTRATRVLLKDLYFANGISMSPDQTHFVFCETIMRRC
SKYYISEERVEVFIQGLPGYPDNIRYDGDGHYWIALISEVTTSWKLSMKYLFLRKLIYMA
AKYGVELLSIKNAAVLQVDLDGNPIAMYHDHPFSHITSGVKIGNHLYFGSLLHSYITRLD
LLKYPAQKKL

MPMFYSSRFLFFFTIVPLLVSIALYQLDTFDPAPVPSEAYASSTTSIPPLISDKYLTGAE
FIGVGLLDKPEDIAYHQDSNLIYTGCIDGWVKRVSVHDSANDSVVEDWVNTGGRPLGIAF
GVHGEVIVADAYKGLLNISGDGKKTELLTDQAEGVKFKLTDVVAVADNGVLYFTDASYKY
TLHQVKFDILEGKPHGRLMSFDPTTRVTRVLLKDLYFANGVSMSPDQTHLIFCETPMRRC
SKYYINEERVEVFIQGLPGYPDNIRYDGDGHYWIAMVSGASTLWRLSMKYPFLRKITAIA
AKYGVELMFMKNAGVLQVDLDGNPIAYYHDQRLSHITTGIKIGNYLYCGNILHSYIIRLD
LLKYPAQKKKL

www.000webhost.com

Other information
Ka divergence:-0.246808KaKs divergence:-0.285399
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):1113Length 2 (bp):1116Length divergence:0.001
MFE 1 (kcal):-327.04MFE 2 (kcal):-354.9MFE divergence0.041