Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G51640-AT3G51650
Species:Arabidopsis
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.24409253861438
Log2 mRNA fold difference:0.0067502958496943
Log2 TE fold difference:-0.29012742660927
Sequences
Protein sequence

MCILCGIQKWSRQVATMLPWFVIPLIGLWALSQLLPPAFRFEITSPRLACVFVLLVTLFW
YEVLMPQLSTWRVRRNAQLRERERLEAIELQKLKKNATRRCRNCSNPYRDQNPGGGKFMC
SYCGHVSKRPVLDMALSSGLEISGSGILKDLVGRGGKMLNGKGWSENGYLHRQEWSDNST
WTSGSSYWRNNSGDTFEGDENCLVEKSYSGGVVFACRLLTSFFMSILWLWRKIFRFSSSV
GDSSLDPEQRRMLARQGENGTSCHESRVEKARRKAEEKRQARLEKEHSEEEERKQREEVA
RLVEERRRLRDEILEAEKCSKLSVAAKEKDTKEAEKKRQERRKERDRASSKSNSDGEEVD
KRTRKETEQKRGLYKSDHLEQERHAPDNLRVPNMERRHGHGLENNVTSNGTKSGGRYFDR
MKGTFLSSSKAFTDSRLFGRGVNTSATIARENKPIGSADNSHTYAHSSHTNPPEFVAMKY
VPNEEERNTNNPVVSEPKPSREPKKSWHQLFARSTPAPVSSNVNTISRPSTNPQPNVQSS
QVPSQVSSIRTFDNPISFGLPSPFTIPVYSSGSTTSSLGFSPPTELVFPQPGEDERFEDP
CYVPDPISLLGPVSESLDLRAAGYETGIGQVKYQAMKNTPSCEANKPSPIESPLSRSRAA
DEKQANDGSWQMWKSPLGQNGLGLVGGSANWVIPSEISRSIEESDMHHAPQHRTESLFSK
EDCQLHQGAYSQRKDYLEHDQRSGVFSPITGPTTTDPWSQKMFFPALSGIESPFSTTTQT
KSVLNNAAGYRSPTGSGSDNPFEHPSPNHWLKKVKSSGNGSGKQVLAAGEVENHQKDVES
FW

MCILCVIQKWSRQVATMLPWFVIPLIGLWALSQLLPPAFRFEITSPRLACVFVLLVTLFW
YEVLMPQLSTWRVRRNAQLRERERLEAIELQKLKKNATRRCRNCSNPYRDQNPGGGKFMC
SYCGHVSKRPVLDMALSSGLEISGSGILKDLVGRGGKMLNGKGWSENGYLHRQEWSDNST
WTSGSSYWRNNSGDTFEGDENCLVEKSYSGGVVFACRLLTSFFMSILWLWRKIFRFSSSV
GDSSLDPEQRRMLARQGENGTSSHESRVEKARRKAEEKRQARLEKEHSEEEERKQREEVA
RLVEERRRLRDEILEAEKCSKFSVAAKEKDTKEAEKKRQERRKERDRASSKSNSDGEEVD
KRTRKETEQKRGLNKSDHLEHERHAPDNLRGPNMERRHGHGLENNVTSNGTKSGGRYFDR
MKSTTFSSSKAFTDSRIFGRGVNTSATFARENKPTGSADNSHTYAHSSHINPPDFVAMKS
VPNEEERNTNNPVVSEPKPSREPRKSWHQLFARSTPAPVSSNVNTISRPSTNPQPNVQIS
QVPSQVSSIRTFDNSISFGLPSPFTIPVYSSGSTTSSLGFSPPTEFVFPQPGEDERFEDP
CYVPDPISLLGPVSESLDLRAAGYETGIGQVKYHAMKNTPSCEANKPSPIESPLSRSRAA
DEKQANDGSWQMWKSPLGQNGLGLVGGSANWVLPSEISRSIEESDMHHAPQHRTESLFSK
EDCQLHQGAYSQRKDYLEHDQRSGVFSPITGPTTTDPWSQKMFFPALSGIESPFSITTQT
KSVLNNAAGYRSPTGSGPDNPFEHPSPNHWLKKVKSSGDGTGKQVLAAGEVENHQKDVES
FW

www.000webhost.com

Other information
Ka divergence:0.511478KaKs divergence:0.662664
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2529Length 2 (bp):2529Length divergence:0
MFE 1 (kcal):-750.55MFE 2 (kcal):-735.36MFE divergence-0.01