Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G55000-AT3G55005
Species:Arabidopsis
Duplication type:TD
Function (paralog1):tonneau family protein
Function (paralog2):tonneau 1b (TON1b)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.48111959626458
Log2 mRNA fold difference:-0.44562639100179
Log2 TE fold difference:0.039127133477944
Sequences
Protein sequence

MDDYTREMMDLKTLVTRTLEKKGVLAKIRAELRASVFEAIEEEDRVIENNEGPPPALLGS
CNDRARKLHASPSGRLLSALICEYLDWAQLNHTLIVYQPESNLPKDSWKSELRDFNSNNG
FELNRNGDSGPLLLDVLEGFLKFESMTQGMGSSSRRDSETESSSSLESRNPPRRSSASDS
LPPQRRPVSASQASDRRAGLSTSGYRKDEFNWRQGNQDTHEEVTRASAALENLQLDRKTR
NLTSSWRNVRDGTNEEEGRD

MDDYTREMMDLKTLVTRTLEKKGVLAKIRAELRASVFEAIEEEDRVIENNEGLPPALLGS
CNDRARQLHASPSGRLLSALICEYLDWAQLNHTLKVYQPECNSAKDSWKSEIRDFSINNG
YELNRNEDSRPLLLDVLEGFLKFENMTQVMGGSSRRESETESSLSLDTRNPPRRSSASDS
LPHQRRSVSASQASGAATSGYRKDESNWRYDTEDMPEEVMRASTALENLQLDRKTRNLTS
SWRNVKDGTSEEEEGKD

www.000webhost.com

Other information
Ka divergence:0.0570051KaKs divergence:0.347657
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):783Length 2 (bp):774Length divergence:-0.006
MFE 1 (kcal):-221.56MFE 2 (kcal):-221.74MFE divergence0