Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G57240-AT3G57260
Species:Arabidopsis
Duplication type:TD
Function (paralog1):beta-1,3-glucanase 3
Function (paralog2):beta-1,3-glucanase 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.4422157930813
Log2 mRNA fold difference:0.99684489309718
Log2 TE fold difference:1.7151574753455
Sequences
Protein sequence

MKMCNGSSFLASLPLLLLLLSFILASFFDTAVGQIGVCYGRNGNNLRPASEVVALYQQRN
IRRMRLYDPNQETLNALRGSNIELVLDVPNPDLQRLASSQAEADTWVRNNVRNYANVTFR
YISVGNEVQPSDQAASFVLPAMQNIERAVSSLGIKVSTAIDTRGISGFPPSSGTFTPEFR
SFIAPVISFLSSKQSPLLVNNYPYFSYTGNMRDIRLDYTLFTAPSTVVNDGQNQYRNLFH
AILDTVYASLEKAGGGSLEIVVSESGWPTAGGAATGVDNARTYVNNLIQTVKNGSPRRPG
RATETYIFAMFDENSKQGPETEKFWGLFLPNLQPKYVVNFN

MSESRSLASPPMLMILLSLVIASFFNHTAGQIGVCYGMLGDTLPSPSDVVALYKQQNIQR
MRLYGPDPGALAALRGSDIELILDVPSSDLERLASSQTEADKWVQENVQSYRDGVRFRYI
NVGNEVKPSVGGFLLQAMQNIENAVSGAGLEVKVSTAIATDTTTDTSPPSQGRFRDEYKS
FLEPVIGFLASKQSPLLVNLYPYFSYMGDTANIHLDYALFTAQSTVDNDPGYSYQNLFDA
NLDSVYAALEKSGGGSLEIVVSETGWPTEGAVGTSVENAKTYVNNLIQHVKNGSPRRPGK
AIETYIFAMFDENKKEPTYEKFWGLFHPDRQSKYEVNFN

Other information
Ka divergence:0.0413503KaKs divergence:0.974477
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):1026Length 2 (bp):1020Length divergence:-0.003
MFE 1 (kcal):-354.14MFE 2 (kcal):-324.34MFE divergence-0.044