Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G58560-AT3G58580
Species:Arabidopsis
Duplication type:TD
Function (paralog1):DNAse I-like superfamily protein
Function (paralog2):DNAse I-like superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.96331027288187
Log2 mRNA fold difference:-0.42105359447585
Log2 TE fold difference:-0.26657823058885
Sequences
Protein sequence

MLSVIRVHLPSEIPIVGCELTPYVLLRRPDKTPSTDDVPESAPLEGHFLKYRWFRVQSDK
KVAICSVHPSETATLQCLGCLKSKVPVAKSYHCSTKCFSDAWQHHRVLHERAASAATEGN
DEEELPRLNSSGSGSGVLSTSVSLTNGSSSVYPSAITQKTGAGGETLVEVGRSKTYTPMA
DDICHVLKFECVVVNAETKQNVGLSCTILTSRVIPAPSPSPRRLISISGTDVTGHLDSNG
RPLSMGTFTVLSYNILSDTYASSDIYSYCPTWALAWTYRRQNLLREIVKYRADIVCLQEV
QNDHFEEFFLPELDKHGYQGLFKRKTNEVFIGNTNTIDGCATFFRRDRFSHVKKYEVEFN
KAAQSLTEAIIPVSQKKNALNRLVKDNVALIVVLEAKFGSQAADNPGKRQLLCVANTHVN
VPHELKDVKLWQVHTLLKGLEKIAASADIPMLVCGDFNTVPASAPHTLLAVGKVDPLHPD
LMVDPLGILRPHSKLTHQLPLVSAYSQFAKMGGNVITEQQRRRLDPASSEPLFTNCTRDF
IGTLDYIFYTADTLTVESLLELLDEESLRKDTALPSPEWSSDHIALLAEFRCMPRARRNN
IL

MLSVIRVHLPSEIPIVGCELTPYVLVRRPDKNSTTDDVPESAPLEGYFLRYRWYRVQSDK
KVTICSVHPTEQATLQCVFCSKRRSLVPKSYHCSPKCFTDAWQHHRTLHERAAAENNANE
DDDLNRNNSAGSGSLAGSLSGSMSNLSIANNGPAPFYPSNITQKNGGETLVEVGGCKTYT
PTADDISHVLKFECVVANAETKQIVGHPSTILTSRVIPAPSPSPRKLIPVNGADGMGHLD
QDARIQSAGSFTVLSYNILSDTSASSDLYSYCPPWALSWPYRRQNLLREIVGYRADVVCL
QEVQSDHFHEIFAPELDKHGYQALYKRKTNEVLSGSTSAIDGCATFFRRDRFSHVKKYDV
EFNKAAQSLTDALIPQAQKRTALNRLVKDNIALIVVLEAKFGNQPTDPSGKRQLICVANT
HVNVQQDLKDVKLWQVHTLLKGLEKIAASADIPMLVCGDFNTLPGSAPHTLLVMGKVDPM
HPDLAVDPLNILRPHTKLTHQLPLVSAYSSFVRKGIMGLGLEQHRRRIDLNTNEPLFTNC
TRDFIGTHDYIFYTADTLMVESLLELLDEDGLRKDTALPSPEWSSNHIALLAEFRCTPRT
RRG

Other information
Ka divergence:0.183048KaKs divergence:0.826531
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1809Length 2 (bp):1812Length divergence:0.001
MFE 1 (kcal):-553.83MFE 2 (kcal):-543.62MFE divergence-0.009