Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G61723-AT3G61740
Species:Arabidopsis
Duplication type:TD
Function (paralog1):PHD finger protein
Function (paralog2):SET domain protein 14

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.46944877825889
Log2 mRNA fold difference:-2.3094799940108
Log2 TE fold difference:1.7012826876148
Sequences
Protein sequence

MYYVCCDGRNVWVHAGCDIITNERFKELEHNNYYCPDCKVLESLFPDTTRSGCTPLWIRN
AAAKRGSREDRSR

MILKRTLTTFENQNLKRCKIDSEIEYGRKKGEIIVYKKRQRATVDQPCSKEPELLTSSSS
SLTSKEESQQVCSDQSKSSRGRVRAVPSRFKDSIVGTWKSSRRKGESTESSHDDDDVSLG
KKVKGFSGSSKLHRSKDSKVFPRKDNGDSSEVDCDYWDVQISYDDANFGMPKKSDASRKG
VYKPEEFTVGDLVWAKCGKRFPAWPAVVIDPISQAPDGVLKHCVPGAICVMFFGYSKDGT
QRDYAWVRQGMVYPFTEFMDKFQDQTNLFNYKASEFNKALEEAVLAENGNFGDAEIISPD
SSATESDQDYGPASRFQGSYHEDIRTCDGCGSVMPLKSLKRTKDSQPEELLCKHCSKLRK
SNQYCGICKRIWHPSDDGDWVCCDGCDVWVHAECDNITNERFKELEHNNYYCPDCKVQHE
LTPTILEEQNSVFKSTEKTTETGLPDAITVVCNGMEGTYIRKFHAIECKCGSCGSRKQSP
SEWERHTGCRAKKWKYSVRVKDTMLPLEKWIAEFSTYTLETQMLDKQKMLSLLEEKYEPV
RAKWTTERCAVCRWVEDWEENKMIICNRCQVAVHQECYGVSKSQDLTSWVCRACETPDIE
RDCCLCPVKGGALKPSDVEGLWVHVTCAWFRPEVGFLNHENMEPAVGLFKIPANSFLKVC
TICKQTHGSCVHCCKCATHFHAMCASRAGYNMELHCLEKNGVQRTRKSVYCSFHRKPDPD
SVVVVHTPSGVFGSRNLLQNQYGRAKGSRLVLTKKMKLPGFQTQTQAEQSRVFDSLSAAR
CRIYSRSNTKIDLEAISHRLKGPSHHSLSAIENLNSFKASFSFRAPFMSVFCFLGATFSE
YLRKILISIYLVTHQEADFTSFRERLKHLQRTENFRVCFGKSGIHGWGLFARKSIQEGEM
IIEYRGVKVRRSVADLREANYRSQGKDCYLFKISEEIVIDATDSGNIARLINHSCMPNCY
ARIVSMGDGEDNRIVLIAKTNVAAGEELTYDYLFEVDESEEIKVPCLCKAPNCRKFMN

www.000webhost.com

Other information
Ka divergence:-0.594127KaKs divergence:0.606742
GC content 1 (%):50GC content 2 (%):43GC content divergence:-0.075
Length 1 (bp):222Length 2 (bp):3057Length divergence:0.865
MFE 1 (kcal):-60.3MFE 2 (kcal):-935.93MFE divergence0.879