Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G62740-AT3G62750
Species:Arabidopsis
Duplication type:TD
Function (paralog1):beta glucosidase 7
Function (paralog2):beta glucosidase 8

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.23476999162932
Log2 mRNA fold difference:-0.50729608441663
Log2 TE fold difference:-0.25388977349526
Sequences
Protein sequence

MKPFSQFFVFVVTVSATSYIDAFTRNDFPNDFLFGAATSAYQWEGAFDEDGKSPSVWDTT
SHCDSGSNNGDIACDGYHKYKEDVMLMAEMGLESFRFSISWSRLIPNGRGRINPKGLLFY
KNLIKELRSHGIEPQVTLYHYDLPQSLEDEYGGWINRKIIEDFTAFADVCFREFGEDVKL
WTKINEATLFAIGSYGDGMRYGHCPPMNYSTANVCTETYIAGHNMLLAHSSASNLYKLKY
KTKQRGSVGLSIYAYGLSPYTDSKDDETATERAEAFLFGWMLKPLVVGDYPDIMKRTLGS
RLPVFSEEESKQVKGSSDFVGVVHYNTFYVTNRPAPSLVTSINKLFFADIGAYLIAAGNA
SLFEFDAVPWGLEGILQHIKQSYNNPPIYILENGKPMKHGSTLQDTPRAEFIQAYIGAVH
NAITNGSDTRGYFVWSMIDLYELIGRYMTSYGMYYVNFSDPGRKRSPKLSASWYTGFLNG
TIDVASQDTIQLQRKCSGSSSL

MKHFNLLSIILVIVLATSYIDAFTRNDFPEDFLFGAGTSAYQWEGAANEDGRTPSVWDTT
SHCYNGSNGDIACDGYHKYKEDVKLMAEMGLESFRFSISWSRLIPNGRGRINPKGLLFYK
NLIKELRSHGIEPHVTLYHYDLPQSLEDEYGGWINHKIIEDFTAFADVCFREFGEDVKLW
TTINEATIFAFAFYGKDVRYGNCTTGNYCMETYIAGHNMLLAHASASNLYKLKYKSKQRG
SIGLSIFALGLTPYTNSKDDEIATQRAKAFLYGWMLKPLVFGDYPDEMKRTLGSRLPVFS
EEESEQVKGSSDFVGIIHYTTVYVTNQPAPYIFPSSTNKDFFTDMGAYIISTGNSSSFVF
DAVPWGLEGVLQHIKHRYNNPPIYILENGSPMKHDSMLQDTPRVEYIQAYIGAVLNAIKS
GSDTRGYFVWSLIDLFEVQVGYKSSFGMYYVNFSDPGRKRSPKLSASWYTGFLNGTIDVA
SQDMTQLQRNFSGSSSL

www.000webhost.com

Other information
Ka divergence:-0.1646KaKs divergence:-0.426419
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1509Length 2 (bp):1494Length divergence:-0.005
MFE 1 (kcal):-428.69MFE 2 (kcal):-419.84MFE divergence-0.01