Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G02360-AT4G02370
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Protein of unknown function, DUF538
Function (paralog2):Protein of unknown function, DUF538

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.061440432776
Log2 mRNA fold difference:0.95446638311341
Log2 TE fold difference:0.70497075642058
Sequences
Protein sequence

MSLDANTCSIVFFLFFTVSFAVSGQKPTAYDAVKLYNLPPGILPKGVVDYELNPKTGNFK
VYFNDTCEFTIQSYQLKYKSTISGVISPGHVKNLKGVSVKVLFFWVNIAEVSLDGADLDF
SVGIASASFPAANFEESPQCGCGFDCNNGLLFSS

MSRLPILIASCLFLSSLTAAVVTAAESDTPTAYSLLQSYNFPVGILPKGVVAYDLDTTTG
KFHAYFNDSCSFNLVGSYQLNYKSTISGYISENKLKKLTGVKVKVLFLWLNIVEVIRNGD
EMEFSVGITSANFAIQEFLESPQCGCGFECKDSKLDMIERIPFLSSS

www.000webhost.com

Other information
Ka divergence:-0.137734KaKs divergence:-0.0373095
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):465Length 2 (bp):504Length divergence:0.04
MFE 1 (kcal):-120.7MFE 2 (kcal):-145.91MFE divergence0.095