Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G02850-AT4G02860
Species:Arabidopsis
Duplication type:TD
Function (paralog1):phenazine biosynthesis PhzC/PhzF family protein
Function (paralog2):Phenazine biosynthesis PhzC/PhzF protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.03888327345809
Log2 mRNA fold difference:0.56152626665428
Log2 TE fold difference:-0.66106670150033
Sequences
Protein sequence

MAMLVKKPVKYFMVDAFTESAFKGNQAAVCFLEEDHERDDVWLQSMASEFDLPLTCFLIP
IPGSEPPRFLLRWFTAVAEMDICGHATLASAHSIFSNSLVGSSDTVEFSTNSGILTAKRL
SDCDSKRSFLIEMNFPVITTCEYSSKDVSIFSKALNGATIVDVRETKTDRLIFKPLIGAF
KTTSTDQIIVVLSSWESVIEFQPRVDDIVKCPGKVMIVTAAAPQGSPFDFCSRLFAPKLG
LNEDSVCGSAHCSLAHYWSLKMNKCDFVAFAASQRSGTLKVHYDKEKQRVLLTGKAVTVM
KGSILV

MCDGKKEKNITLLKKIDRDMGKKKGVKYFVVDAFTDSAFKGNPAAVCFLNDDNERDDTWL
QSLAAEFNISETCFLIPITGFQARFSLRWFTPLAEVDLCGHATLASAHCLFSNGLVDSDM
VEFVTRSGILTAKRVSDTSELSDGEVKGGTFLIELNFPVVTTCDVNLSDVSSSMITKALN
GATIVDIKATATNNILVVLPSKESVTELQPRMDDILKCPCDGIIVTAAGSTGSSYDFYSR
YFAPKFGVDEDPVCGSAHCALAHYWSIKMNKFDFLAYQASSRSGTIRIHLDKEKQRVLLR
GKAVTVMEGHVLV

www.000webhost.com

Other information
Ka divergence:-0.0728238KaKs divergence:-0.165733
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):921Length 2 (bp):942Length divergence:0.011
MFE 1 (kcal):-271.8MFE 2 (kcal):-275.23MFE divergence0.006