Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G03820-AT4G22270
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF3537)
Function (paralog2):Protein of unknown function (DUF3537)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.84994120046213
Log2 mRNA fold difference:2.6877999153544
Log2 TE fold difference:-3.1830773590567
Sequences
Protein sequence

MEESSNQQILNSETRPDPIQKPPESPATKLSFPRLFLWFDQSNRIKTLLSWSIFFLLAVI
VPMISHFVLICADCDFKHRRPYDGLVQLSLSIFAGISFVSLSDWSKKYGIRRFLFFDKLK
DVSDKVRIGYEAKIQRSMKLLAIFVLPSTTLQAIYRIWWYASGFNQIPYIINPTLSHVLA
CTLQLSSWLYRTSLFIIACILYQNICHLQVLRLDEFARCFASEIKDFSSILAEHLKIRRE
LKIVSHRFRRFILLSLFFVTATQFMALLTTIRASVPFNIYEVGELALCSTSLVSGLFICL
KSATQMTHKAQSVTSIATKWNVCASLDTFDVLYDGETPKCPTTTQHSQILSRRRNVVQSS
DDDEEGEGDDNDLEIHPIFARAISSQKRQALVTYLENNRAGITVYGFLVDKTWLRMIFSI
ELALLLWLLKKTISNFICFYSESIFSFFITFLL

MATNGSSEHLLPETTRPSAIINKQQPEFPASRFTFMSLVLWFDQSNFGTALLSWSVFFLL
VVIVPLISHFLLVCSDCDFHHRRPYDVIVQLSLSIFAGISFVSLSIWSRKFGMRRFLFLD
KLWDVSDKVRIEYEAEIQRSLKRLMIFVLPSLTLEATYRIWWYISGFNQIPYIINPILSH
VVACTLQLSSWLYRNSLFIIVCILYKITCHLQTLRLDDFARCFASEITDVRSALGEHQKI
RRNLRIVSHRFRRFILLSLILVTATQFMALLTTTRASVAVNIYEVGELALCSLSLVTGVF
ICLRSATKITHKAQSVTSLAAKWNVCATVDSFDHLDGETPTGSIIESQVSLRGNAIETSD
DEEGEGDDDLDNTKIHPIYANTISYQKRQALVTYLENNKAGITVYGFLVDRSWLNTIFGI
ELALLLWLLNKTIVNIP

www.000webhost.com

Other information
Ka divergence:-0.129143KaKs divergence:-0.527491
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1362Length 2 (bp):1314Length divergence:-0.018
MFE 1 (kcal):-346.21MFE 2 (kcal):-357.32MFE divergence0.016